From PneumoWiki
Jump to navigation Jump to search
PangenomeTIGR4
serotype 4
D39
serotype 2
D39V
serotype 2
Hungary19A-6
serotype 19A
EF3030
serotype 19F
670-6B
serotype 6B
6A-10
serotype 6A
70585
serotype 5
A026
serotype 19F
A66
serotype 3
AP200
serotype 11A
ASP0581
serotype 12F
ATCC 49619
serotype 19F
ATCC 700669
serotype 23F
BM6001
serotype 19F
BVJ1JL
serotype 1
CGSP14
serotype 14
G54
serotype 19F
HU-OH
serotype 3
Hu15
serotype 19A
Hu17
serotype 19A
INV104
serotype 1
INV200
serotype 14
JJA
serotype 14
MDRSPN001
serotype 19F
NCTC7465
serotype 1
NCTC7466
serotype 2
NU83127
serotype 4
OXC141
serotype 3
P1031
serotype 1
R6
serotype 2
SP49
serotype 19A
SPN032672
serotype 1
SPN034156
serotype 3
SPN034183
serotype 3
SPN994038
serotype 3
SPN994039
serotype 3
SPNA45
serotype 3
ST556
serotype 19F
TCH8431/19A
serotype 19A
Taiwan19F-14
serotype 19F
Xen35
serotype 4
gamPNI0373
serotype 1

NCBI: 03-APR-2017

Summary[edit | edit source]

  • organism: Streptococcus pneumoniae Hu17
  • locus tag: SPNHU17_01556 [new locus tag: SPNHU17_RS07250 ]
  • pan locus tag?: PNEUPAN002803000
  • symbol: SPNHU17_01556
  • pan gene symbol?:
  • synonym:
  • product: acetyltransferase, gnat family

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SPNHU17_01556 [new locus tag: SPNHU17_RS07250 ]
  • symbol: SPNHU17_01556
  • product: acetyltransferase, gnat family
  • replicon: chromosome
  • strand: -
  • coordinates: 1440832..1441296
  • length: 465
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGAAATTCCAATTAAGATTATTCAGGCAAGCAAGTCTGATTTGCCTGAGATAGGGGCA
    CTTCAGACCTCGTCTTTTCCAGCTGAAAAGCAGCAACTTTCCCATATTTTAGAAGAAAGT
    ATCCGTAAGTGTGCGGATACCTTTCTTCTAGCTAGGGATGAAAATCAACTTTTAGGCTAT
    ATTTTATCAAGTCCCCAGTCAGACAATCCGCAATATCTAAAAGTACATTCTTTAGTCATC
    GAGTCTGACCATCAGAGACAGGGCTTGGGAACACTTCTTCTTGCAGCCTTGAAAGAGGTG
    GCAGTTGAGCTGGATTACAAAGGGATTCGTTTGGAGAGTCCTGATGAGCTGCTTTCCTAT
    TTTGAAATGAACGGTTTTGTTGATGAAGAAGCAACTTTGCTCTATGCAACTAGCCAGGGC
    TATAGTATGATTTGGTTTAATCCCTTTTATCTGGAGGAACAATGA
    60
    120
    180
    240
    300
    360
    420
    465

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SPNHU17_01556 [new locus tag: SPNHU17_RS07250 ]
  • symbol: SPNHU17_01556
  • description: acetyltransferase, gnat family
  • length: 154
  • theoretical pI: 4.19555
  • theoretical MW: 17456.7
  • GRAVY: -0.194805

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 35.4)
    and 2 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs mycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 13.6)
    Cellular processes Cellular processes Adaptations to atypical conditions diaminobutyrate acetyltransferase (TIGR02406; EC 2.3.1.178; HMM-score: 12.8)
  • TheSEED: data available for D39, Hungary19A-6, TIGR4
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 48.6)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 40.2)
    and 2 more
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 29.2)
    FR47; FR47-like protein (PF08445; HMM-score: 13.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9716
    • Cytoplasmic Membrane Score: 0.0099
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0183
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003947
    • TAT(Tat/SPI): 0.000557
    • LIPO(Sec/SPII): 0.000551
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: ARD35115 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MEIPIKIIQASKSDLPEIGALQTSSFPAEKQQLSHILEESIRKCADTFLLARDENQLLGYILSSPQSDNPQYLKVHSLVIESDHQRQGLGTLLLAALKEVAVELDYKGIRLESPDELLSYFEMNGFVDEEATLLYATSQGYSMIWFNPFYLEEQ

Experimental data[edit | edit source]

  • protein localization:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Expression data[edit | edit source]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]