Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 04-FEB-2016
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae INV200
- locus tag: SPNINV200_08940 [new locus tag: SPNINV200_RS04790 ]
- pan locus tag?: PNEUPAN001972000
- symbol: secG
- pan gene symbol?: secG
- synonym:
- product: putative protein-export membrane protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNINV200_08940 [new locus tag: SPNINV200_RS04790 ]
- symbol: secG
- product: putative protein-export membrane protein
- replicon: chromosome
- strand: +
- coordinates: 903363..903596
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: FQ312029 (903363..903596) NCBI
- BioCyc: see SPNINV200_RS04790
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0861 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTATAACCTATTATTAACCATTTTATTAGTATTATCTGTTGTGATTGTGATTGCAATT
TTCATGCAACCAACCAAAAACCAATCCAGCAATGTATTTGATGCCAGTTCAGGTGATTTG
TTTGAACGCAGTAAAGCTCGCGGTTTTGAAGCTGTAATGCAGCGTTTGACAGGGATTTTA
GTCTTTTTCTGGCTAGCCATTGCCTTAGCATTGACGGTATTATCAAGTAGATAA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNINV200_08940 [new locus tag: SPNINV200_RS04790 ]
- symbol: SecG
- description: putative protein-export membrane protein
- length: 77
- theoretical pI: 10.2322
- theoretical MW: 8550.15
- GRAVY: 0.91039
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking preprotein translocase, SecG subunit (TIGR00810; HMM-score: 56.3)
- TheSEED :
- Protein translocase membrane subunit SecG
- PFAM: no clan defined SecG; Preprotein translocase SecG subunit (PF03840; HMM-score: 52.1)and 6 moreBatA; Aerotolerance regulator N-terminal (PF07584; HMM-score: 15.7)ODV-E18; Occlusion-derived virus envelope protein ODV-E18 (PF10717; HMM-score: 15.4)Serinc; Serine incorporator (Serinc) (PF03348; HMM-score: 15)Herpes_glyco (CL0146) Herpes_UL49_5; Herpesvirus UL49.5 envelope/tegument protein (PF05702; HMM-score: 13.9)no clan defined Anthrone_oxy; Anthrone oxygenase (PF08592; HMM-score: 12.8)DUF3742; Protein of unknown function (DUF3742) (PF12553; HMM-score: 9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9988
- Cell wall & surface Score: 0
- Extracellular Score: 0.0012
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.125718
- TAT(Tat/SPI): 0.000719
- LIPO(Sec/SPII): 0.045373
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CBW34527 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MYNLLLTILLVLSVVIVIAIFMQPTKNQSSNVFDASSGDLFERSKARGFEAVMQRLTGILVFFWLAIALALTVLSSR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0861 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]