Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 04-FEB-2016
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae INV200
- locus tag: SPNINV200_09560 [new locus tag: SPNINV200_RS05100 ]
- pan locus tag?: PNEUPAN002007000
- symbol: SPNINV200_09560
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNINV200_09560 [new locus tag: SPNINV200_RS05100 ]
- symbol: SPNINV200_09560
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 961861..962178
- length: 318
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312029 (961861..962178) NCBI
- BioCyc: see SPNINV200_RS05100
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATGGCAAGTAAAAGATTAAGTATTGAAGAACAGATTGAAAAGAAAGAAGAAAGCATT
AAGCAATTACAAAATCAAAAAAGACAGTTGAAGAAAAAACTTAATGAACAAGAAAGAAAA
GCAAGAAACAAAAGACTTATAGAAAAAGGTGCAGTGTTTGAAAGTATTTTTGAAGAAAGT
ATTGATTTAACAAAAGATGAATTTTATAAGTTAATAAAAACGTTAAATGATGAAGAAATA
AGATTAAACATAATGGAAATTTTAGAAGAAAGAATAGATGATAATGTAGAAAAATCATCT
AAAGATGAAATAACATAA60
120
180
240
300
318
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNINV200_09560 [new locus tag: SPNINV200_RS05100 ]
- symbol: SPNINV200_09560
- description: hypothetical protein
- length: 105
- theoretical pI: 5.12613
- theoretical MW: 12628.4
- GRAVY: -1.07524
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Pathogenesis type III secretion regulator YopN/LcrE/InvE/MxiC (TIGR02568; HMM-score: 12)Protein fate Protein and peptide secretion and trafficking type III secretion regulator YopN/LcrE/InvE/MxiC (TIGR02568; HMM-score: 12)PRTRC system protein E (TIGR03741; HMM-score: 11)
- TheSEED :
- FIG01115356: hypothetical protein
- PFAM: no clan defined DUF3847; Protein of unknown function (DUF3847) (PF12958; HMM-score: 58.2)and 8 moreDUF2802; Protein of unknown function (DUF2802) (PF10975; HMM-score: 15.4)HTH (CL0123) SLIDE; SLIDE (PF09111; HMM-score: 12.3)no clan defined Spc24; Spc24 subunit of Ndc80 (PF08286; HMM-score: 10.9)Cortex-I_coil; Cortexillin I, coiled coil (PF09304; HMM-score: 9.2)RRP14; 60S ribosome biogenesis protein Rrp14 (PF15459; HMM-score: 9.2)RapA_C; RNA polymerase recycling family C-terminal (PF12137; HMM-score: 8.9)TMEM192; TMEM192 family (PF14802; HMM-score: 7.5)LMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9327
- Cytoplasmic Membrane Score: 0.0202
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.0464
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003221
- TAT(Tat/SPI): 0.000522
- LIPO(Sec/SPII): 0.000646
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CBW34589 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MMASKRLSIEEQIEKKEESIKQLQNQKRQLKKKLNEQERKARNKRLIEKGAVFESIFEESIDLTKDEFYKLIKTLNDEEIRLNIMEILEERIDDNVEKSSKDEIT
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]