Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 13-DEC-2020
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae INV200
- locus tag: SPNINV200_RS09300 [old locus tag: SPNINV200_17330 ]
- pan locus tag?: PNEUPAN003500000
- symbol: SPNINV200_RS09300
- pan gene symbol?: ytpP
- synonym:
- product: thioredoxin family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNINV200_RS09300 [old locus tag: SPNINV200_17330 ]
- symbol: SPNINV200_RS09300
- product: thioredoxin family protein
- replicon: chromosome
- strand: -
- coordinates: 1764049..1764366
- length: 318
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_017593 (1764049..1764366) NCBI
- BioCyc: SPNINV200_RS09300 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1714 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATACAGCCAGCAAGTTTAGAAGAATTAGCATCTTTAGTGGAAAAAGCGGGCAAGAAG
GTCTTCCTTTTTGTGGCAGACTGGTGTGGCGATTGTCGTTATATTTATCCTGCCTTACCA
GAGATTGAAGAGACCAATCCAGAGTTCACCTTTATTCGAATGGACCGAGATCAGTATATG
GATTTGGCCAAACTCTGGGATGTTTACGGAATTCCTAGCCTTGTTGTTCTAGAAAAGGAC
AAGGAAATCGGTCGTTTTGTCAATCGCGACCGTAAAAGTAAGGAGCAAATTAACGATTTT
TTAGCAGGATTGAAATAG60
120
180
240
300
318
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNINV200_RS09300 [old locus tag: SPNINV200_17330 ]
- symbol: SPNINV200_RS09300
- description: thioredoxin family protein
- length: 105
- theoretical pI: 4.59863
- theoretical MW: 12220
- GRAVY: -0.270476
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 52.6)and 5 moreProtein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 32.2)protein disulfide isomerase (TIGR01130; HMM-score: 24.9)glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 13.3)Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 13.2)glutaredoxin-like protein (TIGR02200; HMM-score: 12.9)
- TheSEED: see SPNINV200_17330
- PFAM: Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 54)and 4 moreThioredoxin_9; Thioredoxin (PF14595; HMM-score: 38.1)Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 23)Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 19.5)Thioredoxin_7; Thioredoxin-like (PF13899; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.029506
- TAT(Tat/SPI): 0.000522
- LIPO(Sec/SPII): 0.011747
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000615767 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIQPASLEELASLVEKAGKKVFLFVADWCGDCRYIYPALPEIEETNPEFTFIRMDRDQYMDLAKLWDVYGIPSLVVLEKDKEIGRFVNRDRKSKEQINDFLAGLK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1714 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.