Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 26-AUG-2017
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae OXC141
- locus tag: SPNOXC11580 [new locus tag: SPNOXC_RS06245 ]
- pan locus tag?: PNEUPAN002589000
- symbol: SPNOXC11580
- pan gene symbol?: crcB1
- synonym: crcB
- product: CrcB-like protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNOXC11580 [new locus tag: SPNOXC_RS06245 ]
- symbol: SPNOXC11580
- product: CrcB-like protein
- replicon: chromosome
- strand: -
- coordinates: 1188409..1188738
- length: 330
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312027 (1188409..1188738) NCBI
- BioCyc: see SPNOXC_RS06245
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1149 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGTAATCGTCTATCTTGCAATCGCCTGTGGCTTGGGAGCACTCGTACGGTATTTCTTT
TCCCGCTACAATCAAGCTTCTAAATTGCCACTTGGAACGCTCATAGCTAATCTTTTAGGT
TGTTTTTTAATTGGAGTATTCTACAATCATGTAGAGTCTAAGGAAGTATATGCTATTCTA
GCAACAGGATTTTGTGGCGGTTTAACAACTTTTTCGACCTTGAATGACGAACTTCAAAGA
CTGCTAAGTGATAAGAAGGTCTTTTATTCTTACCTGACTTTGACTTACATAGGTGGTTTG
GTTGCGATTTTTTTAGGAATTTTGCTATAA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNOXC11580 [new locus tag: SPNOXC_RS06245 ]
- symbol: SPNOXC11580
- description: CrcB-like protein
- length: 109
- theoretical pI: 8.44625
- theoretical MW: 11988.2
- GRAVY: 0.905505
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General protein CrcB (TIGR00494; HMM-score: 71.9)and 3 moreTransport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, mannose/fructose/sorbose family, IID component (TIGR00828; HMM-score: 15.1)Signal transduction PTS PTS system, mannose/fructose/sorbose family, IID component (TIGR00828; HMM-score: 15.1)oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 9.5)
- TheSEED :
- Fluoride ion exporter CrcB/FEX
- PFAM: DMT (CL0184) CRCB; CrcB-like protein, Camphor Resistance (CrcB) (PF02537; HMM-score: 79.9)and 5 moreno clan defined YLATT; YEATS-Like-Associating Three TM (PF20303; HMM-score: 17.4)Voltage_CLC; Voltage gated chloride channel (PF00654; HMM-score: 13.8)DUF4203; Domain of unknown function (DUF4203) (PF13886; HMM-score: 13.8)Ferritin (CL0044) DUF3231; Protein of unknown function (DUF3231) (PF11553; HMM-score: 13.7)BPD_transp_1 (CL0404) FtsX; FtsX-like permease family (PF02687; HMM-score: 9.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9996
- Cell wall & surface Score: 0
- Extracellular Score: 0.0003
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.018602
- TAT(Tat/SPI): 0.000445
- LIPO(Sec/SPII): 0.023267
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CBW32814 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MVIVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTTFSTLNDELQRLLSDKKVFYSYLTLTYIGGLVAIFLGILL
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1149 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]