Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 26-AUG-2017
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae OXC141
- locus tag: SPNOXC18770 [new locus tag: SPNOXC_RS10415 ]
- pan locus tag?: PNEUPAN003681000
- symbol: SPNOXC18770
- pan gene symbol?: —
- synonym:
- product: conserved hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNOXC18770 [new locus tag: SPNOXC_RS10415 ]
- symbol: SPNOXC18770
- product: conserved hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1915959..1916300
- length: 342
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312027 (1915959..1916300) NCBI
- BioCyc: see SPNOXC_RS10415
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1954 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAGAGACGATATCAAAATCAATGACCGTGCTTTGGCCTTGCAAGACCAAATTATCGAA
AAACTAGAGAAAGTTTTTGATACAGATGTGGAATTGGATGTTTACAATCTAGGTCTGATT
TATGAAATCAATCTGGATGAAACGGGGCTCTGCAAGATTGTCATGACCTTCACCGATACT
GCCTGTGATTGCGCCGAAAGCCTGCCTATTGAAATCGTGGCAGGTCTGAAACAAATCGAG
GGTATCAAAGATATCAAGGTTGAAGTTACCTGGTCGCCTGCCTGGAAAATCACACGAATC
AGTCGCTATGGCCGTATTGCCCTTGGACTACCACCTCGTTAA60
120
180
240
300
342
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNOXC18770 [new locus tag: SPNOXC_RS10415 ]
- symbol: SPNOXC18770
- description: conserved hypothetical protein
- length: 113
- theoretical pI: 4.3775
- theoretical MW: 12809.8
- GRAVY: 0.00884956
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system protein (TIGR02945; HMM-score: 93.7)and 2 moreBiosynthesis of cofactors, prosthetic groups, and carriers Other probable FeS assembly SUF system protein SufT (TIGR03406; HMM-score: 54.3)Energy metabolism Other phenylacetate-CoA oxygenase, PaaJ subunit (TIGR02159; HMM-score: 22.2)
- TheSEED :
- PaaD-like protein (DUF59) involved in Fe-S cluster assembly
- probably aromatic ring hydroxylating enzyme, evidenced by COGnitor
- PFAM: NifU (CL0232) FeS_assembly_P; Iron-sulfur cluster assembly protein (PF01883; HMM-score: 34.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008158
- TAT(Tat/SPI): 0.000214
- LIPO(Sec/SPII): 0.000457
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CBW33529 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MRDDIKINDRALALQDQIIEKLEKVFDTDVELDVYNLGLIYEINLDETGLCKIVMTFTDTACDCAESLPIEIVAGLKQIEGIKDIKVEVTWSPAWKITRISRYGRIALGLPPR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1954 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.