Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae P1031
- locus tag: SPP_2088 [new locus tag: SPP_RS10285 ]
- pan locus tag?: PNEUPAN003684000
- symbol: SPP_2088
- pan gene symbol?: comGD
- synonym:
- product: competence protein CglD
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPP_2088 [new locus tag: SPP_RS10285 ]
- symbol: SPP_2088
- product: competence protein CglD
- replicon: chromosome
- strand: -
- coordinates: 1908590..1908994
- length: 405
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000920 (1908590..1908994) NCBI
- BioCyc: see SPP_RS10285
- MicrobesOnline: 7482565 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1860 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATTAAGGCCTTTACCATGCTGGAAAGTCTCTTGGTTTTGGGTCTTGTGAGTATCCTT
GCCTTGGGCTTGTCCGGCTCTGTTCAGTCCACTTTTGCGGCAGTAGAGGAACAGATTTTC
TTTATGGAATTTGAAGAACTCTATCGGGAAACCCAAAAACGCAGTGTAGCCAGTCAGCAA
AAGACTAGTCTGAACTTAGATGGGCAGACGATTAGCAATGGCAGTCAAAAGTTGCCAGTC
CCTAAAGGAATTCAGGTCCCATCAGGCCAAAGTATTACATTTGACCGTGCTGGGGGCAAT
TCGTCCCTGGCTAAGGTTGAATTTCAGACCAGTAAAGGAGCGATTCGCTATCAATTATAT
CTAGGAAATGGAAAAATTAAACGCATTAAGGAAACAAAAAATTAG60
120
180
240
300
360
405
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPP_2088 [new locus tag: SPP_RS10285 ]
- symbol: SPP_2088
- description: competence protein CglD
- length: 134
- theoretical pI: 10.2201
- theoretical MW: 14662.8
- GRAVY: -0.150746
⊟Function[edit | edit source]
- TIGRFAM: Cell envelope Surface structures prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 16.1)Protein fate Protein and peptide secretion and trafficking prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 16.1)
- TheSEED :
- Late competence protein ComGD, access of DNA to ComEA, FIG038316
- PFAM: no clan defined N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.9968
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0029
- SignalP: Signal peptide SP(Sec/SPI) length 33 aa
- SP(Sec/SPI): 0.930385
- TAT(Tat/SPI): 0.018051
- LIPO(Sec/SPII): 0.037432
- Cleavage Site: CS pos: 33-34. TFA-AV. Pr: 0.8320
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACO21780 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKAFTMLESLLVLGLVSILALGLSGSVQSTFAAVEEQIFFMEFEELYRETQKRSVASQQKTSLNLDGQTISNGSQKLPVPKGIQVPSGQSITFDRAGGNSSLAKVEFQTSKGAIRYQLYLGNGKIKRIKETKN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SPP_2085 < SPP_2086 < SPP_2087 < SPP_2088 < SPP_2089 < SPP_2090 < SPP_2091 < SPP_2092
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1860 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]