Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 25-NOV-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae R6
- locus tag: SPR_RS08960 [old locus tag: spr1784 ]
- pan locus tag?: PNEUPAN003587000
- symbol: rsmD
- pan gene symbol?: rsmD
- synonym:
- product: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPR_RS08960 [old locus tag: spr1784 ]
- symbol: rsmD
- product: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD
- replicon: chromosome
- strand: -
- coordinates: 1758014..1758553
- length: 540
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_003098 (1758014..1758553) NCBI
- BioCyc: see spr1784
- MicrobesOnline: see spr1784
- PneumoBrowse for strain D39V: SPV_1767 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAAAATCGTATCAGGAATCTATGGGGGACGTCCCCTCAAGACACTAGAAGGCAAGACA
ACAAGACCTACTTCGGATAAGGTTAGGGGAGCCATTTTTAACATGATTGGTCCCTACTTT
GAAGGGGGACGAGTCTTGGACCTTTATGCAGGTAGTGGTGGTTTATCTATCGAAGCAGTA
TCGCGTGGCATGTCCAGTGCTGTTTTGGTGGAGCGAGACCGTAAGGCTCAGACCATCGTG
GCTGAAAATATCCAGATGACCAAGGAAGTTGGAAAATTTCAACTCCTCAAGATGGATGCA
GAGAGGGCATTGGAACAGGTATCTGGGGAATTTGACCTCGTTTTCTTAGACCCTCCCTAT
GCCAAGGAACAAATCGTAGCAGATATTGAAAAAATGGCTAAGAGAGAGCTTTTTTCTGAA
GATGTTATGGTTGTGTGCGAGACGGATAAGGCCGTTGAACTTCCAGAAGAGATTGCCTGT
CTGGGTATCTGGAAGGAAAAGATTTATGGAATTAGTAAGGTGACAGTCTATGTCAGATAA60
120
180
240
300
360
420
480
540
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPR_RS08960 [old locus tag: spr1784 ]
- symbol: RsmD
- description: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD
- length: 179
- theoretical pI: 5.14482
- theoretical MW: 19842.9
- GRAVY: -0.0837989
⊟Function[edit | edit source]
- reaction: EC 2.1.1.171? ExPASy16S rRNA (guanine966-N2)-methyltransferase S-adenosyl-L-methionine + guanine966 in 16S rRNA = S-adenosyl-L-homocysteine + N2-methylguanine966 in 16S rRNA
- TIGRFAM: Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD (TIGR00095; EC 2.1.1.171; HMM-score: 171)and 10 moreBiosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 32.9)Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 29.3)Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 26.8)Hypothetical proteins Conserved putative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 22.7)Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 19.2)Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 16.7)Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 16.1)Protein synthesis tRNA and rRNA base modification NOL1/NOP2/sun family putative RNA methylase (TIGR00446; EC 2.1.1.-; HMM-score: 15.8)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 15.4)DNA metabolism DNA replication, recombination, and repair DNA adenine methylase (TIGR00571; EC 2.1.1.72; HMM-score: 15.1)
- TheSEED: see spr1784
- PFAM: NADP_Rossmann (CL0063) Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 209)and 16 moreMTS; Methyltransferase small domain (PF05175; HMM-score: 26.4)Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 21.9)Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 21.7)N6-adenineMlase; Probable N6-adenine methyltransferase (PF10237; HMM-score: 20.3)Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 19.8)MethyltransfD12; D12 class N6 adenine-specific DNA methyltransferase (PF02086; HMM-score: 18.6)PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 18.2)Methyltrans_SAM; S-adenosylmethionine-dependent methyltransferase (PF10672; HMM-score: 17.6)RsmJ; Ribosomal RNA large subunit methyltransferase D, RlmJ (PF04378; HMM-score: 16.7)UPF0020; Putative RNA methylase family UPF0020 (PF01170; HMM-score: 15.6)Met_10; Met-10+ like-protein (PF02475; HMM-score: 15.5)SAM_MT; Putative SAM-dependent methyltransferase (PF04445; HMM-score: 15.5)Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 15)TRM; N2,N2-dimethylguanosine tRNA methyltransferase (PF02005; HMM-score: 14.4)Methyltransf_30; S-adenosyl-L-methionine-dependent methyltransferase (PF05430; HMM-score: 13.8)DNA_methylase; C-5 cytosine-specific DNA methylase (PF00145; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9985
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0011
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.026628
- TAT(Tat/SPI): 0.002088
- LIPO(Sec/SPII): 0.00143
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKIVSGIYGGRPLKTLEGKTTRPTSDKVRGAIFNMIGPYFEGGRVLDLYAGSGGLSIEAVSRGMSSAVLVERDRKAQTIVAENIQMTKEVGKFQLLKMDAERALEQVSGEFDLVFLDPPYAKEQIVADIEKMAKRELFSEDVMVVCETDKAVELPEEIACLGIWKEKIYGISKVTVYVR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SPR_RS08950 < coaD < rsmD < asnA
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1767 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]