Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Taiwan19F-14
- locus tag: SPT_1020 [new locus tag: SPT_RS05035 ]
- pan locus tag?: PNEUPAN002446000
- symbol: SPT_1020
- pan gene symbol?: xseB
- synonym:
- product: conserved domain protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPT_1020 [new locus tag: SPT_RS05035 ]
- symbol: SPT_1020
- product: conserved domain protein
- replicon: chromosome
- strand: +
- coordinates: 964328..964540
- length: 213
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000921 (964328..964540) NCBI
- BioCyc: see SPT_RS05035
- MicrobesOnline: 7474751 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1066 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTCAAAACAAAAGAAATTTGAGGAAAATCTAGCAGAACTGGAAACCATTGTCCAAAGT
TTGGAAAATGGTGAAATTGCTCTGGAAGATGCGATTACTGCCTTTCAAAAGGGCATGGTC
TTGTCAAAAGAGCTCCAAGCTACGCTGGACAAGGCTGAAAAGACCTTGGTCAAGGTCATG
CAAGAAGACGGAACAGAAAGTGATTTTGAATGA60
120
180
213
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPT_1020 [new locus tag: SPT_RS05035 ]
- symbol: SPT_1020
- description: conserved domain protein
- length: 70
- theoretical pI: 4.07767
- theoretical MW: 7849.82
- GRAVY: -0.485714
⊟Function[edit | edit source]
- reaction: EC 3.1.11.6? ExPASyExodeoxyribonuclease VII Exonucleolytic cleavage in either 5'- to 3'- or 3'- to 5'-direction to yield nucleoside 5'-phosphates
- TIGRFAM: DNA metabolism Degradation of DNA exodeoxyribonuclease VII, small subunit (TIGR01280; EC 3.1.11.6; HMM-score: 72.4)
- TheSEED :
- Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)
- PFAM: no clan defined Exonuc_VII_S; Exonuclease VII small subunit (PF02609; HMM-score: 65.7)and 3 moreTrimer_CC; Trimerisation motif (PF08954; HMM-score: 15)DUF6687; Family of unknown function (DUF6687) (PF20392; HMM-score: 13.5)RL10P_insert; Insertion domain in 60S ribosomal protein L10P (PF17777; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9958
- Cytoplasmic Membrane Score: 0.0024
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0017
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001964
- TAT(Tat/SPI): 0.000301
- LIPO(Sec/SPII): 0.000225
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSKQKKFEENLAELETIVQSLENGEIALEDAITAFQKGMVLSKELQATLDKAEKTLVKVMQEDGTESDFE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1066 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]