Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 06-SEP-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae D39V
- locus tag: SPV_0191 [new locus tag: SPV_RS01060 ]
- pan locus tag?: PNEUPAN000936000
- symbol: SPV_0191
- pan gene symbol?: udk_1
- synonym:
- product: Hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPV_0191 [new locus tag: SPV_RS01060 ]
- symbol: SPV_0191
- product: Hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 195123..195740
- length: 618
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP027540 (195123..195740) NCBI
- BioCyc: SPV_0191 BioCyc
- MicrobesOnline:
- PneumoBrowse: SPV_0191 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAAGAAAAAAGACTTAGTAGACCAACTAGTCTCAGAGATCGAGACGGGGAAAGTCAGG
ACACTGGGAATATACGGTCATGGAGCTTCAGGTAAATCAACCTTTGCACAGGAATTGTAC
CAAGCTTTAGATTCTACTACAGTAAATTTGCTAGAGACAGATCCTTATATCACCTCAGGA
CGCCATCTGGTAGTACCCAAGGACGCGCCGAATCAAAAGGTGACAGCCAGTCTGCCAGTG
GCGCATGAACTGGAGAGTTTGCAGAGAGATATCCTTGCCTTGCAGGCGGGTATGGATGTC
TTGACAATTGAAGAACCTTGGAAGGCTAGTGAGGTCTTGTCTGGAGCCAAACCAATTTTG
ATTGTCGAAGGGATGTCTGTTGGCTTTCTACCCAAGGAACTCTTTGAAAAAACCATCTGT
TTCTACACGGATGAGGAGACCGAATTAAAGCGACGCCTTGCTAGAGATACGACTGTGAGA
AATCGCGATGCATCCTTTATATTGGCTAGCCATCAGATGAGACGGGAGCAGTATCTGCGA
TACTATAAAGAAACTGAGTCTAAGGCGGATATCTTAGTGGACCAATCAGAAGATAAATTT
GATGTCAAGAGGACTTAA60
120
180
240
300
360
420
480
540
600
618
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPV_0191 [new locus tag: SPV_RS01060 ]
- symbol: SPV_0191
- description: Hypothetical protein
- length: 205
- theoretical pI: 5.41554
- theoretical MW: 23194.2
- GRAVY: -0.423415
⊟Function[edit | edit source]
- TIGRFAM: Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 48.9)and 9 morearsenical pump-driving ATPase (TIGR04291; EC 3.6.1.-; HMM-score: 13.1)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 13.1)Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A dephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 12.9)Central intermediary metabolism Nitrogen fixation nitrogenase iron protein (TIGR01287; EC 1.18.6.1; HMM-score: 12.3)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 11.7)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 11.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 11.5)DNA metabolism DNA replication, recombination, and repair phage/plasmid primase, P4 family, C-terminal domain (TIGR01613; HMM-score: 11.4)Mobile and extrachromosomal element functions Prophage functions phage/plasmid primase, P4 family, C-terminal domain (TIGR01613; HMM-score: 11.4)
- TheSEED: data available for D39, Hungary19A-6
- PFAM: P-loop_NTPase (CL0023) PRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 47.5)and 12 moreAAA_18; AAA domain (PF13238; HMM-score: 21)AAA_16; AAA ATPase domain (PF13191; HMM-score: 20.9)AAA_33; AAA domain (PF13671; HMM-score: 19.9)AAA_17; AAA domain (PF13207; HMM-score: 16.3)CoaE; Dephospho-CoA kinase (PF01121; HMM-score: 15.7)Thymidylate_kin; Thymidylate kinase (PF02223; HMM-score: 15.6)NB-ARC; NB-ARC domain (PF00931; HMM-score: 13.8)no clan defined Sortase; Sortase domain (PF04203; HMM-score: 13)P-loop_NTPase (CL0023) KTI12; Chromatin associated protein KTI12 (PF08433; HMM-score: 12.6)ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 12.2)MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 12)Fer4_NifH; 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family (PF00142; HMM-score: 11.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.996
- Cytoplasmic Membrane Score: 0.0017
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0022
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.030744
- TAT(Tat/SPI): 0.008226
- LIPO(Sec/SPII): 0.003368
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: AVN85367 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKKKDLVDQLVSEIETGKVRTLGIYGHGASGKSTFAQELYQALDSTTVNLLETDPYITSGRHLVVPKDAPNQKVTASLPVAHELESLQRDILALQAGMDVLTIEEPWKASEVLSGAKPILIVEGMSVGFLPKELFEKTICFYTDEETELKRRLARDTTVRNRDASFILASHQMRREQYLRYYKETESKADILVDQSEDKFDVKRT
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Expression data[edit | edit source]
- PneumoExpress: SPV_0191 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Jelle Slager, Rieza Aprianto, Jan-Willem Veening
Refining the Pneumococcal Competence Regulon by RNA Sequencing.
J Bacteriol: 2019, 201(13);
[PubMed:30885934] [WorldCat.org] [DOI] (I e)