Jump to navigation
		Jump to search
		
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 08-SEP-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae D39V
 - locus tag: SPV_RS10375 [old locus tag: SPV_1960 ]
 - pan locus tag?: PNEUPAN003815000
 - symbol: SPV_RS10375
 - pan gene symbol?: ulaB2
 - synonym:
 - product: PTS sugar transporter subunit IIB
 
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
 - locus tag: SPV_RS10375 [old locus tag: SPV_1960 ]
 - symbol: SPV_RS10375
 - product: PTS sugar transporter subunit IIB
 - replicon: chromosome
 - strand: -
 - coordinates: 1929074..1929358
 - length: 285
 - essential: unknown
 
⊟Accession numbers[edit | edit source]
- Location: NZ_CP027540 (1929074..1929358) NCBI
 - BioCyc: see SPV_1960
 - MicrobesOnline:
 - PneumoBrowse: SPV_1960 PneumoBrowse
 
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTAAAAATTGGTACAGCTTGTGGTTCAGGATTAGGTTCAAGTTTTATGGTACAGATG
AATATTGAATCTGTATTGAGTGATTTGAATGTTTCGGATGTAGAAGTTGAACATTATGAT
TTAGGTGGAGCAGATCCAAATGCAGCTGATATTTGGATTGTTGGTCGTGATCTAGCTGAT
TCAGCTAGTCATCTTGGAGATGTTCGTATCTTAAATAGTATTATTGATATGGATGAACTA
CGAGAATTAATTACTAAACTTTGTGAAGAAAAAGGACTTATATAG60
120
180
240
285 
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPV_RS10375 [old locus tag: SPV_1960 ]
 - symbol: SPV_RS10375
 - description: PTS sugar transporter subunit IIB
 - length: 94
 - theoretical pI: 3.96118
 - theoretical MW: 10105.4
 - GRAVY: 0.181915
 
⊟Function[edit | edit source]
- reaction: EC 2.7.1.-? ExPASy
 - TIGRFAM:
 - TheSEED: data available for D39, Hungary19A-6, TIGR4
 - PFAM: Phosphatase (CL0031) PTS_IIB; PTS system, Lactose/Cellobiose specific IIB subunit (PF02302; HMM-score: 47.2)
 
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
 - modifications:
 - cofactors:
 - effectors:
 
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
 - Cytoplasmic Membrane Score: 1.15
 - Cellwall Score: 0.62
 - Extracellular Score: 0.73
 - Internal Helices: 0
 
 - DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9958
 - Cytoplasmic Membrane Score: 0.0016
 - Cell wall & surface Score: 0.0001
 - Extracellular Score: 0.0025
 
 - SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.210169
 - TAT(Tat/SPI): 0.002991
 - LIPO(Sec/SPII): 0.005619
 
 - predicted transmembrane helices (TMHMM): 0
 
⊟Accession numbers[edit | edit source]
- GI:
 - RefSeq: WP_000912476 NCBI
 - UniProt:
 
⊟Protein sequence[edit | edit source]
- MLKIGTACGSGLGSSFMVQMNIESVLSDLNVSDVEVEHYDLGGADPNAADIWIVGRDLADSASHLGDVRILNSIIDMDELRELITKLCEEKGLI
 
⊟Experimental data[edit | edit source]
- protein localization:
 - interaction partners:
 
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
 
⊟Expression data[edit | edit source]
- PneumoExpress: SPV_1960 PneumoExpress
 
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]