Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_0206
- pan locus tag?:
- symbol: SP_0206
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_0206
- symbol: SP_0206
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 192159..192461
- length: 303
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AE005672 (192159..192461) NCBI
- BioCyc:
- MicrobesOnline: 115745 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAGAAAAAGGACTTAGTAGACCAACTAGTCTCAGAGATCGAGACGGGGAAAGTCAGG
ACACTGGGAATATACGGTCATGGAGCTTCAGGTAAATCAACCTTTGCACAGGAATTGTAC
CAAGCTTTAGATTCTACTACAGTAAATTTGCTAGAGACAGATCCTTATATCACCTCAGGA
CGCCATCTGGTAGTACCCAAGGACGCGCCGAATCAAAAGGTGACAGCCAGTCTGCCAGTG
GCGCATGAACTGGAGAGTTTGCAGAGAGATATCCTTGCTTGCAGGCGGGTATGGATGTCT
TGA60
120
180
240
300
303
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_0206
- symbol: SP_0206
- description: hypothetical protein
- length: 100
- theoretical pI: 7.60781
- theoretical MW: 11066.6
- GRAVY: -0.284
⊟Function[edit | edit source]
- TIGRFAM: Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 21.1)and 9 morearsenical pump-driving ATPase (TIGR04291; EC 3.6.1.-; HMM-score: 16)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 14.5)Central intermediary metabolism Nitrogen fixation nitrogenase iron protein (TIGR01287; EC 1.18.6.1; HMM-score: 14.1)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 13.5)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 13.5)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 13.3)DNA metabolism DNA replication, recombination, and repair phage/plasmid primase, P4 family, C-terminal domain (TIGR01613; HMM-score: 13)Mobile and extrachromosomal element functions Prophage functions phage/plasmid primase, P4 family, C-terminal domain (TIGR01613; HMM-score: 13)Energy metabolism Photosynthesis chlorophyllide reductase iron protein subunit X (TIGR02016; HMM-score: 10.8)
- TheSEED :
- FIG01114116: hypothetical protein
- PFAM: P-loop_NTPase (CL0023) AAA_16; AAA ATPase domain (PF13191; HMM-score: 20.6)AAA_33; AAA domain (PF13671; HMM-score: 19.7)and 13 moreNB-ARC; NB-ARC domain (PF00931; HMM-score: 15.7)KTI12; Chromatin associated protein KTI12 (PF08433; HMM-score: 14)MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 13.8)ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 13.7)Fer4_NifH; 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family (PF00142; HMM-score: 13.2)PRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 13.1)DO-GTPase1; Double-GTPase 1 (PF19975; HMM-score: 12.3)HHH (CL0198) HHH_4; Helix-hairpin-helix containing domain (PF14490; HMM-score: 12.2)P-loop_NTPase (CL0023) RNA_helicase; RNA helicase (PF00910; HMM-score: 12.1)AAA_PrkA; PrkA AAA domain (PF08298; HMM-score: 12)AB_hydrolase (CL0028) Chlorophyllase; Chlorophyllase (PF07224; HMM-score: 11.5)P-loop_NTPase (CL0023) GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 11.4)Parvo_NS1; Parvovirus non-structural protein NS1 (PF01057; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9495
- Cytoplasmic Membrane Score: 0.0275
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.0223
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.030744
- TAT(Tat/SPI): 0.008226
- LIPO(Sec/SPII): 0.003368
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKKDLVDQLVSEIETGKVRTLGIYGHGASGKSTFAQELYQALDSTTVNLLETDPYITSGRHLVVPKDAPNQKVTASLPVAHELESLQRDILACRRVWMS
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site: 192019 [1]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)