Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 23-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_RS00810 [old locus tag: SP_0157 ]
- pan locus tag?: PNEUPAN000873000
- symbol: SP_RS00810
- pan gene symbol?: —
- synonym:
- product: ABC transporter permease
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_RS00810 [old locus tag: SP_0157 ]
- symbol: SP_RS00810
- product: ABC transporter permease
- replicon: chromosome
- strand: +
- coordinates: 154918..155451
- length: 534
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_003028 (154918..155451) NCBI
- BioCyc:
- MicrobesOnline: see SP_0157
- PneumoBrowse for strain D39V: SPV_0159 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAAAAAGAAACCAATTTATCTATGGGTTTTGCTAATCTTGTCTGCCCTTATTTCAGTT
CCGTCTCTGTTTGGAATTGTGAGTCCCTTGCCTAGTAAAGAAGCCCTTCGTGCTGCTCAG
AAACAAGTTGCAGGGGTCAATGCTCAGCAATTAGAAGACCAGCTTAATTATACCTATAGA
GTAGCAGAAGCATCTCATTCTATTTTTAATGTTGCTTTGATTGTGCTATCTACTATTTTA
GTGGTCGTAGCGATTGTCTTCCTTGTTCGTAAAAATTTGCAATATGCAAACTATACTTAC
GTTGGCTATGTTTTGTTAGCTATTATTGGTTCGATTTATGGCTATGTTGGTTTACAAGAC
GCTGTGCAGTTGGTTCAAGATGAGAGCATGCGTTTGACAGTGAGTATTGGTTCAAAAGCT
GTTAGCATTTTCTATATCGTCATCAATGTTCTCTTCCTAGCCCTTGTCTTCTATAAGATG
TGGCGACAACAGAAAGCCTTGGCAGAAGAAGAGGAAACAGAAGAGCTTACCTAA60
120
180
240
300
360
420
480
534
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_RS00810 [old locus tag: SP_0157 ]
- symbol: SP_RS00810
- description: ABC transporter permease
- length: 177
- theoretical pI: 8.67357
- theoretical MW: 19805.2
- GRAVY: 0.601695
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SP_0157
- PFAM: no clan defined DUF3169; Protein of unknown function (DUF3169) (PF11368; HMM-score: 21.8)OSTbeta; Organic solute transporter subunit beta protein (PF15048; HMM-score: 19.9)and 17 moreDUF2157; Predicted membrane protein (DUF2157) (PF09925; HMM-score: 16.6)DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 14.8)DUF4052; Protein of unknown function (DUF4052) (PF13261; HMM-score: 14.2)2heme_cytochrom (CL0328) DUF2231; Predicted membrane protein (DUF2231) (PF09990; HMM-score: 13.3)no clan defined PspB; Phage shock protein B (PF06667; HMM-score: 12.9)TRP; Transient receptor potential (TRP) ion channel (PF06011; HMM-score: 12.6)DUF846; Eukaryotic protein of unknown function (DUF846) (PF05832; HMM-score: 12.4)GPCR_A (CL0192) Ceramidase; Ceramidase (PF05875; HMM-score: 12.1)no clan defined Trp_oprn_chp; Tryptophan-associated transmembrane protein (Trp_oprn_chp) (PF09534; HMM-score: 12)MAP17; Membrane-associated protein 117 kDa, PDZK1-interacting protein 1 (PF15807; HMM-score: 11.1)DUF3671; Protein of unknown function (PF12420; HMM-score: 9.5)Renin_r; Renin receptor-like protein (PF07850; HMM-score: 9.3)DUF202; Domain of unknown function (DUF202) (PF02656; HMM-score: 7.9)SLATT (CL0676) DUF4231; Protein of unknown function (DUF4231) (PF14015; HMM-score: 7.7)no clan defined DUF4282; Domain of unknown function (DUF4282) (PF14110; HMM-score: 7.4)Tetraspannin (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 6.8)no clan defined DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 6.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0004
- Cytoplasmic Membrane Score: 0.9101
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.089
- SignalP: Signal peptide SP(Sec/SPI) length 38 aa
- SP(Sec/SPI): 0.888298
- TAT(Tat/SPI): 0.030468
- LIPO(Sec/SPII): 0.02538
- Cleavage Site: CS pos: 38-39. LRA-AQ. Pr: 0.2088
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKKPIYLWVLLILSALISVPSLFGIVSPLPSKEALRAAQKQVAGVNAQQLEDQLNYTYRVAEASHSIFNVALIVLSTILVVVAIVFLVRKNLQYANYTYVGYVLLAIIGSIYGYVGLQDAVQLVQDESMRLTVSIGSKAVSIFYIVINVLFLALVFYKMWRQQKALAEEEETEELT
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0159 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)