Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 23-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_RS04960 [old locus tag: SP_1000 ]
- pan locus tag?: PNEUPAN002003000
- symbol: sdbB
- pan gene symbol?: sdbB
- synonym:
- product: thiol-disulfide oxidoreductase-associated lipoprotein SdbB
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_RS04960 [old locus tag: SP_1000 ]
- symbol: sdbB
- product: thiol-disulfide oxidoreductase-associated lipoprotein SdbB
- replicon: chromosome
- strand: +
- coordinates: 940874..941431
- length: 558
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_003028 (940874..941431) NCBI
- BioCyc:
- MicrobesOnline: see SP_1000
- PneumoBrowse for strain D39V: SPV_0886 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAAAAAAGTAATGTTTGCTGGCTTAAGTCTCTTGTCATTAGTTGTATTGATGGCCTGT
GGTGAGGAAGAAACTAAAAAGACTCAAGCAGCACAACAGCCAAAACAACAAACGACTGTA
CAACAAATTGCTGTTGGAAAAGATGCTCCAGACTTCACATTGCAATCCATGGATGGCAAA
GAAGTTAAGTTATCTGATTTTAAGGGTAAAAAGGTTTACTTGAAGTTTTGGGCTTCATGG
TGTGGTCCATGCAAGAAAAGTATGCCAGAGTTGATGGAACTAGCGGCGAAACCAGATCGT
GATTTCGAAATTCTTACTGTCATTGCACCAGGAATTCAAGGTGAAAAAACTGTTGAGCAA
TTCCCACAATGGTTCCAGGAACAAGGATATAAGGATATCCCAGTTCTTTATGATACCAAA
GCAACCACCTTCCAAGCTTATCAAATTCGAAGCATTCCTACAGAATATTTAATTGATAGC
CAAGGAAAGATTGGAAAGATTCAATTTGGTGCTATCAGTAATGCGGATGCAGAAGCAGCA
TTTAAAGAAATGAACTAG60
120
180
240
300
360
420
480
540
558
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_RS04960 [old locus tag: SP_1000 ]
- symbol: SdbB
- description: thiol-disulfide oxidoreductase-associated lipoprotein SdbB
- length: 185
- theoretical pI: 6.64619
- theoretical MW: 20701.8
- GRAVY: -0.329189
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 47.4)Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 42.3)and 9 moreProtein fate Protein folding and stabilization methylamine dehydrogenase accessory protein MauD (TIGR02661; HMM-score: 27.8)Energy metabolism Amino acids and amines methylamine dehydrogenase accessory protein MauD (TIGR02661; HMM-score: 27.8)Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 26.7)protein disulfide isomerase (TIGR01130; HMM-score: 24.7)type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB (TIGR02738; HMM-score: 20.4)TraF-like protein (TIGR02740; HMM-score: 16.7)small lipoprotein, LB_250 family (TIGR04454; HMM-score: 16)Biosynthesis of cofactors, prosthetic groups, and carriers Other Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 12.5)Central intermediary metabolism Nitrogen fixation Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 12.5)
- TheSEED: see SP_1000
- PFAM: Thioredoxin (CL0172) Redoxin; Redoxin (PF08534; HMM-score: 79.3)AhpC-TSA; AhpC/TSA family (PF00578; HMM-score: 77)and 6 moreThioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 43.7)Thioredoxin; Thioredoxin (PF00085; HMM-score: 40.2)Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 30.2)GSHPx; Glutathione peroxidase (PF00255; HMM-score: 17.7)SCO1-SenC; SCO1/SenC (PF02630; HMM-score: 13.1)no clan defined IMP2_N; Immune Mapped Protein 2 (IMP2) N-terminal domain (PF18590; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cellwall
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 0.53
- Cellwall Score: 8.75
- Extracellular Score: 0.7
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9052
- Cell wall & surface Score: 0.0214
- Extracellular Score: 0.0733
- SignalP: Signal peptide LIPO(Sec/SPII) length 19 aa
- SP(Sec/SPI): 0.002487
- TAT(Tat/SPI): 0.000048
- LIPO(Sec/SPII): 0.997319
- Cleavage Site: CS pos: 19-20. LMA-CG. Pr: 0.9978
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKVMFAGLSLLSLVVLMACGEEETKKTQAAQQPKQQTTVQQIAVGKDAPDFTLQSMDGKEVKLSDFKGKKVYLKFWASWCGPCKKSMPELMELAAKPDRDFEILTVIAPGIQGEKTVEQFPQWFQEQGYKDIPVLYDTKATTFQAYQIRSIPTEYLIDSQGKIGKIQFGAISNADAEAAFKEMN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0886 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)