Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 11-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae A026
- locus tag: T308_RS07510 [old locus tag: T308_07365 ]
- pan locus tag?: PNEUPAN003027000
- symbol: T308_RS07510
- pan gene symbol?: manP
- synonym:
- product: PTS fructose transporter subunit IIB
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: T308_RS07510 [old locus tag: T308_07365 ]
- symbol: T308_RS07510
- product: PTS fructose transporter subunit IIB
- replicon: chromosome
- strand: -
- coordinates: 1440343..1440654
- length: 312
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAATTGTTGGTGTTGCAGCTTGTACTGTGGGAATTGCCCACACTTATATTGCACAG
GAAAAATTAGAGAATGCCGCAAAGGTAGCTGGACATGTGATTCATGTTGAGACTCAGGGG
ACAATAGGGGTAGAAAATGAATTGAGTCAAGAGCAGATTGATGCAGCGGATGTAGTTATT
TTAGCAGTTGATGTTAAGATTTCTGGTATGGAACGCTTTGAGGGTAAAAAGATTATCAAG
GTTCCAACAGAAGTGGCAGTCAAATCTCCCAATAAACTGATTGCTAAAGCTGTTGAGATT
GTTACGAAATAA60
120
180
240
300
312
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: T308_RS07510 [old locus tag: T308_07365 ]
- symbol: T308_RS07510
- description: PTS fructose transporter subunit IIB
- length: 103
- theoretical pI: 6.79353
- theoretical MW: 10944.8
- GRAVY: 0.271845
⊟Function[edit | edit source]
- reaction: EC 2.7.1.202? ExPASyProtein-N(pi)-phosphohistidine--D-fructose phosphotransferase [Protein]-N(pi)-phospho-L-histidine + D-fructose(Side 1) = [protein]-L-histidine + D-fructose 1-phosphate(Side 2)
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, Fru family, IIB component (TIGR00829; EC 2.7.1.69; HMM-score: 102)Signal transduction PTS PTS system, Fru family, IIB component (TIGR00829; EC 2.7.1.69; HMM-score: 102)
- TheSEED: data available for Hungary19A-6, TIGR4
- PFAM: Phosphatase (CL0031) PTS_IIB; PTS system, Lactose/Cellobiose specific IIB subunit (PF02302; HMM-score: 65.9)and 1 moreE-set (CL0159) aRib; Atypical Rib domain (PF18938; HMM-score: 15.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.937
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0623
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.215585
- TAT(Tat/SPI): 0.001284
- LIPO(Sec/SPII): 0.009456
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000706301 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKIVGVAACTVGIAHTYIAQEKLENAAKVAGHVIHVETQGTIGVENELSQEQIDAADVVILAVDVKISGMERFEGKKIIKVPTEVAVKSPNKLIAKAVEIVTK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.