Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 670-6B
- locus tag: SP670_2131 [new locus tag: SP670_RS10785 ]
- pan locus tag?: PNEUPAN003685000
- symbol: SP670_2131
- pan gene symbol?: comGC
- synonym:
- product: competence protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP670_2131 [new locus tag: SP670_RS10785 ]
- symbol: SP670_2131
- product: competence protein
- replicon: chromosome
- strand: -
- coordinates: 1989514..1989807
- length: 294
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP002176 (1989514..1989807) NCBI
- BioCyc: see SP670_RS10785
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1861 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGAGAGTTTTACTATCCTTGATTGAGATGTTGGTGGTCTTGCTGATTATCAGCGTGCTT
TTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAGGCAGTCAATGACAAAGGAAAA
GCAGCTGTTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAA
GATGCTAGCCTAAGCAAGTTACAAGCAGATGGGCGAATCACGGAAGAACAGGCTAAAGCT
TATAAAGAATACCATGATAAAAATGGAGTAGCAAATCGTAAAGTCAATGATTAA60
120
180
240
294
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP670_2131 [new locus tag: SP670_RS10785 ]
- symbol: SP670_2131
- description: competence protein
- length: 97
- theoretical pI: 7.5237
- theoretical MW: 10873.6
- GRAVY: -0.0958763
⊟Function[edit | edit source]
- ⊞TIGRFAM: Cellular processes Pathogenesis type II secretion system protein G (TIGR01710; HMM-score: 28.2)Protein fate Protein and peptide secretion and trafficking type II secretion system protein G (TIGR01710; HMM-score: 28.2)and 8 more
- TheSEED :
- Late competence protein ComGC, access of DNA to ComEA, FIG007487
- ⊞PFAM: no clan defined DUF4330; Domain of unknown function (DUF4330) (PF14221; HMM-score: 17.1)NusG_II; NusG domain II (PF07009; HMM-score: 15.8)DUF1980; Domain of unknown function (DUF1980) (PF09323; HMM-score: 14.5)SecD-TM1; SecD export protein N-terminal TM region (PF13721; HMM-score: 14.1)and 2 more
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ADM92183 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MRVLLSLIEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLQADGRITEEQAKAYKEYHDKNGVANRKVND
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1861 PneumoExpress