Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae R6
- locus tag: spr1081 [new locus tag: SPR_RS05395 ]
- pan locus tag?: PNEUPAN002438000
- symbol: spr1081
- pan gene symbol?: PTS-EII_13
- synonym:
- product: Hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: spr1081 [new locus tag: SPR_RS05395 ]
- symbol: spr1081
- product: Hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1076480..1076752
- length: 273
- essential: yes [1] DEG
⊟Accession numbers[edit | edit source]
- Location: AE007317 (1076480..1076752) NCBI
- BioCyc: SPR1081 BioCyc
- MicrobesOnline: 133965 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1058 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGATTCCTCACACAGATATTGTTCATAATCTAGCTGAGAAAGTGGTGGTTGTTCGATTA
GAGAAACCGGTGACTTTCCATAATATGATTGCGCCAGGTAAGGAAGTAGAAGTATCCTTG
CTCTTCTTTATCATCAATAATTCAAGTTCAAGTCAAACGAACATTCTTGCTCAGTTGATG
GACTTTTTCACAGGAAATGGACATCTTGAAGACCTATCAAAAATTTCCGAACCAGAAAAA
CTTTATGCTTATATAGATGAAGCAATCGCTTAA60
120
180
240
273
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: spr1081 [new locus tag: SPR_RS05395 ]
- symbol: spr1081
- description: Hypothetical protein
- length: 90
- theoretical pI: 4.73882
- theoretical MW: 10083.5
- GRAVY: 0.148889
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- PTS system, galactose-specific IIA component (EC 2.7.1.204)
- PFAM: PTase-anion_tr (CL0340) PTS_EIIA_2; Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 (PF00359; HMM-score: 67.6)and 1 moreno clan defined CoV_NSP9; Coronavirus replicase NSP9 (PF08710; HMM-score: 13.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9979
- Cytoplasmic Membrane Score: 0.0014
- Cell wall & surface Score: 0
- Extracellular Score: 0.0007
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002934
- TAT(Tat/SPI): 0.000108
- LIPO(Sec/SPII): 0.000245
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIPHTDIVHNLAEKVVVVRLEKPVTFHNMIAPGKEVEVSLLFFIINNSSSSQTNILAQLMDFFTGNGHLEDLSKISEPEKLYAYIDEAIA
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: spr1078 < spr1079 < spr1080 < spr1081
⊟Regulation[edit | edit source]
- regulators: CcpA regulon, LacR (repression) regulon
CcpA (TF) important in Global catabolite repression; RegPrecise LacR (TF) important in Lactose utilization, Galactose utilization; RegPrecise
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1058 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Jane A Thanassi, Sandra L Hartman-Neumann, Thomas J Dougherty, Brian A Dougherty, Michael J Pucci
Identification of 113 conserved essential genes using a high-throughput gene disruption system in Streptococcus pneumoniae.
Nucleic Acids Res: 2002, 30(14);3152-62
[PubMed:12136097] [WorldCat.org] [DOI] (I p)