Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 17-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae A66
- locus tag: A66_RS12180
- pan locus tag?: PNEUPAN002264000
- symbol: A66_RS12180
- pan gene symbol?: —
- synonym:
- product: HAD hydrolase family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: A66_RS12180
- symbol: A66_RS12180
- product: HAD hydrolase family protein
- replicon: chromosome
- strand: +
- coordinates: 984707..985036
- length: 330
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_LN847353 (984707..985036) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301TTGGAGAGATTAGCAAAATCCCTTGGTATTGCCTATTTCACTGCCAACCAGCTTGAAGTC
AAAGAAGGTCTTTTAACAGGAAAATTAGTTGGACAAATTATAAGTCCCCAGGTCAAAAAA
GAAACTCTGGAAAAATGGAGAAAGAAACTAAAACTTTCTAAAGAAAGAACGGTGGCAATC
GGTGATGGGGTCAATAATCTATTAATGTTGAAGTCGGCGGAGTTAGGAATCGCCTTTTGT
TCCAAAGAAATGCTCAAAAAAGAAATACCACATCATGTTGACAAGAGGGATTTTTTAGAA
GTTCTTCCTTTGATTGACTGTTTAGAATGA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: A66_RS12180
- symbol: A66_RS12180
- description: HAD hydrolase family protein
- length: 109
- theoretical pI: 9.63549
- theoretical MW: 12317.6
- GRAVY: -0.126606
⊟Function[edit | edit source]
- TIGRFAM: Amino acid biosynthesis Serine family phosphoserine phosphatase SerB (TIGR00338; EC 3.1.3.3; HMM-score: 94.2)and 18 moreUnknown function Enzymes of unknown specificity Cof-like hydrolase (TIGR00099; HMM-score: 34.6)phosphoserine phosphatase-like hydrolase, archaeal (TIGR01491; HMM-score: 34.3)Unknown function Enzymes of unknown specificity HAD phosphoserine phosphatase-like hydrolase, family IB (TIGR01488; HMM-score: 34)Unknown function Enzymes of unknown specificity HAD hydrolase, family IB (TIGR01490; HMM-score: 28.5)HAD ATPase, P-type, family IC (TIGR01494; EC 3.6.3.-; HMM-score: 28.5)heavy metal translocating P-type ATPase (TIGR01525; EC 3.6.3.-; HMM-score: 19.3)phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein (TIGR02137; EC 3.1.3.3; HMM-score: 19.2)phosphoglycolate phosphatase, TA0175-type (TIGR01487; EC 3.1.3.18; HMM-score: 16.7)Transport and binding proteins Cations and iron carrying compounds cadmium-translocating P-type ATPase (TIGR01512; EC 3.6.3.3; HMM-score: 15.6)Cellular processes Detoxification copper-translocating P-type ATPase (TIGR01511; EC 3.6.3.4; HMM-score: 14.2)Transport and binding proteins Cations and iron carrying compounds copper-translocating P-type ATPase (TIGR01511; EC 3.6.3.4; HMM-score: 14.2)phospholipid-translocating P-type ATPase, flippase (TIGR01652; EC 3.6.3.1; HMM-score: 13.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family (TIGR01670; EC 3.1.3.45; HMM-score: 13.8)P-type ATPase of unknown pump specificity (type V) (TIGR01657; HMM-score: 12.8)Unknown function Enzymes of unknown specificity HAD hydrolase, family IIB (TIGR01484; HMM-score: 12.3)mannosyl-3-phosphoglycerate phosphatase family (TIGR01486; EC 3.1.3.-; HMM-score: 12.3)Transport and binding proteins Cations and iron carrying compounds calcium-translocating P-type ATPase, SERCA-type (TIGR01116; EC 3.6.3.8; HMM-score: 11.7)potassium/sodium efflux P-type ATPase, fungal-type (TIGR01523; EC 3.6.3.-; HMM-score: 10.2)
- TheSEED:
- PFAM: HAD (CL0137) Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 30.9)Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 28.6)and 3 moreHAD; haloacid dehalogenase-like hydrolase (PF12710; HMM-score: 23.5)S6PP; Sucrose-6F-phosphate phosphohydrolase (PF05116; HMM-score: 14.6)HAD_2; haloacid dehalogenase-like hydrolase (PF13419; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9935
- Cytoplasmic Membrane Score: 0.0026
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0038
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010923
- TAT(Tat/SPI): 0.000709
- LIPO(Sec/SPII): 0.001669
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001809344 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MERLAKSLGIAYFTANQLEVKEGLLTGKLVGQIISPQVKKETLEKWRKKLKLSKERTVAIGDGVNNLLMLKSAELGIAFCSKEMLKKEIPHHVDKRDFLEVLPLIDCLE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]