Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 13-OCT-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae NCTC7465
- locus tag: AT689_RS12925
- pan locus tag?: PNEUPAN002264000
- symbol: AT689_RS12925
- pan gene symbol?: —
- synonym:
- product: HAD family hydrolase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: AT689_RS12925
- symbol: AT689_RS12925
- product: HAD family hydrolase
- replicon: chromosome
- strand: +
- coordinates: 1516001..1516225
- length: 225
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181TTGGAGAGATTAGCAAAATCCCTTGGTATTGCCTATTTCACTGCCAACCAGCTTGAAGTC
AAAGAAGGTCTTTTAACAGGAAAATTAGTTGGACAAATTATAAGTCCCCAGGTCAAAAAA
GAAACTCTGGAAAAATGGAGAAAGAAACTAAAACTTTCTAAAGAAAGAACGGTGGCAATC
GGTGATGGGGTCAATAATCTATTAATGTTGAAGTCGGCGGAGTGA60
120
180
225
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: AT689_RS12925
- symbol: AT689_RS12925
- description: HAD family hydrolase
- length: 74
- theoretical pI: 10.5934
- theoretical MW: 8254.75
- GRAVY: -0.235135
⊟Function[edit | edit source]
- TIGRFAM: Amino acid biosynthesis Serine family phosphoserine phosphatase SerB (TIGR00338; EC 3.1.3.3; HMM-score: 63.5)and 5 moreUnknown function Enzymes of unknown specificity HAD phosphoserine phosphatase-like hydrolase, family IB (TIGR01488; HMM-score: 35.6)phosphoserine phosphatase-like hydrolase, archaeal (TIGR01491; HMM-score: 30)Unknown function Enzymes of unknown specificity HAD hydrolase, family IB (TIGR01490; HMM-score: 29.8)Unknown function Enzymes of unknown specificity Cof-like hydrolase (TIGR00099; HMM-score: 27)HAD ATPase, P-type, family IC (TIGR01494; EC 3.6.3.-; HMM-score: 17.9)
- TheSEED:
- PFAM: HAD (CL0137) Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 30.1)HAD; haloacid dehalogenase-like hydrolase (PF12710; HMM-score: 25)Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 24.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9912
- Cytoplasmic Membrane Score: 0.0056
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0029
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010923
- TAT(Tat/SPI): 0.000709
- LIPO(Sec/SPII): 0.001669
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001844778 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MERLAKSLGIAYFTANQLEVKEGLLTGKLVGQIISPQVKKETLEKWRKKLKLSKERTVAIGDGVNNLLMLKSAE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.