Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 09-DEC-2016
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SP49
- locus tag: BMJ42_00082 [new locus tag: BMJ42_RS00405 ]
- pan locus tag?: PNEUPAN000554000
- symbol: BMJ42_00082
- pan gene symbol?: —
- synonym:
- product: phage protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: BMJ42_00082 [new locus tag: BMJ42_RS00405 ]
- symbol: BMJ42_00082
- product: phage protein
- replicon: chromosome
- strand: -
- coordinates: 62981..63331
- length: 351
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP018136 (62981..63331) NCBI
- BioCyc: see BMJ42_RS00405
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAATATAATTGCTATTATCATAATTGTTATTTTTGTTGGAGGTGTCATAGGTGCAGTA
ATTGATAACCAAAAAAAATCTCCAGAGCAGAGAGAACGTGAACTTGAAACATTTAGAGCA
AATCAAGAGAAGAAAAAGCAAGAGAAAAAGCAGAATATCATCACTTGCCCTAATTGTAAG
TCTAAAGATGTGACTTTCTTACAACAAGACAAAAAAGCCTTTTCTGTTGGAAAGGCCGTT
GGTGGAGCTGTTTTGACTGGTGGAGTTGGTGCTTTAGCTGGATTTGCTGGCAAAAAAGGA
AATAAACAGTGGCATTGCCAAAATTGCGGAAATTTCTTTGAAACGAAATAA60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: BMJ42_00082 [new locus tag: BMJ42_RS00405 ]
- symbol: BMJ42_00082
- description: phage protein
- length: 116
- theoretical pI: 10.331
- theoretical MW: 12681.7
- GRAVY: -0.332759
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Anaerobic phenylphosphate carboxylase, delta subunit (TIGR02726; HMM-score: 15.4)and 5 moreRegulatory functions DNA interactions putative regulatory protein, FmdB family (TIGR02605; HMM-score: 12.2)Cellular processes Sporulation and germination stage III sporulation protein AE (TIGR02829; HMM-score: 11.2)Cys-rich peptide, TIGR04165 family (TIGR04165; HMM-score: 10.7)MJ0042 family finger-like domain (TIGR02098; HMM-score: 8.3)cxxc_20_cxxc protein (TIGR04104; HMM-score: 6.3)
- TheSEED: data available for Hungary19A-6
- PFAM: no clan defined zf-LITAF-like; LITAF-like zinc ribbon domain (PF10601; HMM-score: 22.7)and 26 moreZn_Beta_Ribbon (CL0167) Zn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 16.1)Elf1; Transcription elongation factor Elf1 like (PF05129; HMM-score: 15.3)Lar_restr_allev; Restriction alleviation protein Lar (PF14354; HMM-score: 15.2)Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 15.1)TF_Zn_Ribbon; TFIIB zinc-binding (PF08271; HMM-score: 14.1)CDA (CL0109) YwqJ-deaminase; YwqJ-like deaminase (PF14431; HMM-score: 14)Zn_Beta_Ribbon (CL0167) zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 13.9)no clan defined DUF678; Protein of unknown function (DUF678) (PF05077; HMM-score: 13.8)DUF3169; Protein of unknown function (DUF3169) (PF11368; HMM-score: 13.5)Zn_Beta_Ribbon (CL0167) Prim_Zn_Ribbon; Zinc-binding domain of primase-helicase (PF08273; HMM-score: 13.2)TFIIS_C; Transcription factor S-II (TFIIS) (PF01096; HMM-score: 13.1)no clan defined DUF1043; Protein of unknown function (DUF1043) (PF06295; HMM-score: 13.1)Zn_Beta_Ribbon (CL0167) zf-RING_7; C4-type zinc ribbon domain (PF02591; HMM-score: 13)OrfB_Zn_ribbon; Putative transposase DNA-binding domain (PF07282; HMM-score: 12.8)no clan defined HypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 12.6)Zn_Beta_Ribbon (CL0167) zinc_ribbon_10; Predicted integral membrane zinc-ribbon metal-binding protein (PF10058; HMM-score: 12.3)A2L_zn_ribbon; A2L zinc ribbon domain (PF08792; HMM-score: 11.9)Zn_Tnp_IS1; InsA N-terminal domain (PF03811; HMM-score: 11.4)C2H2-zf (CL0361) zf-H2C2_2; Zinc-finger double domain (PF13465; HMM-score: 10.8)zf-FYVE-PHD (CL0390) FYVE; FYVE zinc finger (PF01363; HMM-score: 10.4)no clan defined RecR; RecR protein (PF02132; HMM-score: 10.2)SpoV; Stage V sporulation protein family (PF08183; HMM-score: 10.2)CRA; Circumsporozoite-related antigen (CRA) (PF06589; HMM-score: 9.7)C2H2-zf (CL0361) Sgf11; Sgf11 (transcriptional regulation protein) (PF08209; HMM-score: 8.4)Zn_Beta_Ribbon (CL0167) zinc_ribbon_4; zinc-ribbon domain (PF13717; HMM-score: 8)no clan defined ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 7.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0016
- Cytoplasmic Membrane Score: 0.5126
- Cell wall & surface Score: 0
- Extracellular Score: 0.4857
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.367557
- TAT(Tat/SPI): 0.0024
- LIPO(Sec/SPII): 0.225502
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: APJ29424 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNIIAIIIIVIFVGGVIGAVIDNQKKSPEQRERELETFRANQEKKKQEKKQNIITCPNCKSKDVTFLQQDKKAFSVGKAVGGAVLTGGVGALAGFAGKKGNKQWHCQNCGNFFETK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]