Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 19-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Xen35
- locus tag: CXP32_RS04160 [old locus tag: CXP32_04160 ]
- pan locus tag?: PNEUPAN001785000
- symbol: CXP32_RS04160
- pan gene symbol?: flaR
- synonym:
- product: DNA topology modulation protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: CXP32_RS04160 [old locus tag: CXP32_04160 ]
- symbol: CXP32_RS04160
- product: DNA topology modulation protein
- replicon: chromosome
- strand: -
- coordinates: 785808..786332
- length: 525
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP025256 (785808..786332) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0731 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAAAATCGCAATTATCGGATATTCTGGTTCTGGTAAGTCAACTATAGCAGAAAAGTTA
TCTAACTACTACTCCATTCCAAAACTGCACATGGACACACTCCAATTTCAACCTGGTTGG
CAAGACAGTGACTGCGAATGGATGTTAACCGAGATAAAAAACTTTCTCACCAAGCATAAA
GCTTGGGTCATCGATGGTAATTATTCTTGGTGCTACTACCAAGAACGAATGCAAGAAGCT
GACCAAATCATCTTTCTCAATTTTTCGCCATTGACCTGTCTCTTTAGAGCCTTTAAGCGT
TATCTTAAATACCGTGGAAAAGTCAGAGAAAGTATGGCGGTAGATTGCCCTGAACGCTTT
GAGTGGGAGTTTATCAGATGGATTCTTTGGGATGGGCGTAGCAAAACTCAAAAAGAAAAT
TACCAAAAACTTTGCCAAGAATATTCACATAAAGTCACTATTCTTCGAAATCAGAGAGAG
CTAGATCAATTTCTGGATAAGAAAAGGAAGTCCTACAATTCATAA60
120
180
240
300
360
420
480
525
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: CXP32_RS04160 [old locus tag: CXP32_04160 ]
- symbol: CXP32_RS04160
- description: DNA topology modulation protein
- length: 174
- theoretical pI: 9.26926
- theoretical MW: 21107.1
- GRAVY: -0.718391
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A dephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 23.3)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 20.9)and 28 moreputative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 17.5)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 15.7)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 15.6)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 14.8)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 14.8)carbohydrate kinase, thermoresistant glucokinase family (TIGR01313; EC 2.7.1.-; HMM-score: 14.6)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 14.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 14.5)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 13.5)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 13.5)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 13.5)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions adenylate kinase (TIGR01351; EC 2.7.4.-; HMM-score: 13.4)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 13.1)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 13.1)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 13.1)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 12.9)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions cytidylate kinase (TIGR00017; EC 2.7.4.14; HMM-score: 12.8)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 12.3)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 12.3)Protein synthesis Other ribosome-associated GTPase EngA (TIGR03594; HMM-score: 12.2)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 11.9)Unknown function General GTP-binding protein HflX (TIGR03156; HMM-score: 11.9)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 11.8)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 11)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 10.9)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 10.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 9.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 9.5)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: P-loop_NTPase (CL0023) AAA_18; AAA domain (PF13238; HMM-score: 27)and 22 morePRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 18.7)ABC_tran; ABC transporter (PF00005; HMM-score: 18.2)dNK; Deoxynucleoside kinase (PF01712; HMM-score: 17.8)AAA_17; AAA domain (PF13207; HMM-score: 17.7)AAA_22; AAA domain (PF13401; HMM-score: 16.9)AAA_7; P-loop containing dynein motor region (PF12775; HMM-score: 16.4)AAA_33; AAA domain (PF13671; HMM-score: 15.8)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 15.2)AAA_16; AAA ATPase domain (PF13191; HMM-score: 15)G-alpha; G-protein alpha subunit (PF00503; HMM-score: 14.4)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 14.4)AAA_28; AAA domain (PF13521; HMM-score: 14.3)ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 14)AAA_24; AAA domain (PF13479; HMM-score: 14)AAA_23; AAA domain (PF13476; HMM-score: 13.6)APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 13.4)CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 12.9)SRP54; SRP54-type protein, GTPase domain (PF00448; HMM-score: 12.7)DUF87; Helicase HerA, central domain (PF01935; HMM-score: 12.7)Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 12.4)SKI; Shikimate kinase (PF01202; HMM-score: 12.2)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.2439
- Cytoplasmic Membrane Score: 0.7478
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0081
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.039517
- TAT(Tat/SPI): 0.000371
- LIPO(Sec/SPII): 0.009765
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000684223 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKIAIIGYSGSGKSTIAEKLSNYYSIPKLHMDTLQFQPGWQDSDCEWMLTEIKNFLTKHKAWVIDGNYSWCYYQERMQEADQIIFLNFSPLTCLFRAFKRYLKYRGKVRESMAVDCPERFEWEFIRWILWDGRSKTQKENYQKLCQEYSHKVTILRNQRELDQFLDKKRKSYNS
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0731 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]