Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 14-DEC-2020
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae HU-OH
- locus tag: EL271_RS09595 [old locus tag: SPOH_1783 ]
- pan locus tag?: PNEUPAN003517000
- symbol: tsaE
- pan gene symbol?: tsaE
- synonym:
- product: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EL271_RS09595 [old locus tag: SPOH_1783 ]
- symbol: tsaE
- product: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
- replicon: chromosome
- strand: -
- coordinates: 1757983..1758426
- length: 444
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_AP018937 (1757983..1758426) NCBI
- BioCyc: EL271_RS09595 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1743 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGTACACAAAAAATGAAGAAGAGTTGCAAGCCTTAGGGGAGCGTTTGGGCCATCTATTA
GCAAAGAATGATGTTTTAATCTTAACTGGAGAACTGGGTGCAGGTAAAACGACCTTTACT
AAAGGACTTGCAAAAGGATTACAGATTTCTCAAATGATTAAAAGTCCCACCTATACTATC
GTGAGAGAGTATGAAGGTCGACTTCCACTTTATCACCTAGATGTTTATCGTATTGAAGGA
GATGCTGATTCTATCGACTTGGATGAGTTTATCTTTGGTGGCGGCGTGACTGTTATTGAG
TGGGGAAATCTCTTAGGAGATGCCTTGCCAGATGCTTATTTAGAATTGGAAATTCTAAAA
GAAGCAGATGGACGCCGTTTAAATTTTCAGGCAAAGGGTTTGCGTGCTGAGAAATTGTTA
GAGGAGCTTCAATATGGAGTATGA60
120
180
240
300
360
420
444
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EL271_RS09595 [old locus tag: SPOH_1783 ]
- symbol: TsaE
- description: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
- length: 147
- theoretical pI: 4.45213
- theoretical MW: 16401.6
- GRAVY: -0.189796
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 114.2)and 5 moreProtein fate Protein and peptide secretion and trafficking putative secretion ATPase, PEP-CTERM locus subfamily (TIGR03015; HMM-score: 17.3)Protein synthesis tRNA aminoacylation L-seryl-tRNA(Sec) kinase (TIGR03574; EC 2.7.1.164; HMM-score: 15.4)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 12.1)Unknown function Enzymes of unknown specificity helicase, RecD/TraA family (TIGR01448; HMM-score: 10.7)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 9.7)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: P-loop_NTPase (CL0023) TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 126)and 16 moreAAA_18; AAA domain (PF13238; HMM-score: 16.1)AAA_33; AAA domain (PF13671; HMM-score: 16)NACHT; NACHT domain (PF05729; HMM-score: 15.6)AAA_22; AAA domain (PF13401; HMM-score: 15.3)AAA_30; AAA domain (PF13604; HMM-score: 13.9)RNA_helicase; RNA helicase (PF00910; HMM-score: 13.8)dNK; Deoxynucleoside kinase (PF01712; HMM-score: 13.5)AAA_25; AAA domain (PF13481; HMM-score: 13.1)NTPase_1; NTPase (PF03266; HMM-score: 12.9)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 12.4)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 12.3)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 12.2)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 12)AAA_7; P-loop containing dynein motor region (PF12775; HMM-score: 11.5)VirE; Virulence-associated protein E (PF05272; HMM-score: 11.3)Myosin_head; Myosin head (motor domain) (PF00063; HMM-score: 9.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.016718
- TAT(Tat/SPI): 0.008564
- LIPO(Sec/SPII): 0.001507
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000288232 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MYTKNEEELQALGERLGHLLAKNDVLILTGELGAGKTTFTKGLAKGLQISQMIKSPTYTIVREYEGRLPLYHLDVYRIEGDADSIDLDEFIFGGGVTVIEWGNLLGDALPDAYLELEILKEADGRRLNFQAKGLRAEKLLEELQYGV
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1743 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.