From PneumoWiki
Jump to navigation Jump to search
PangenomeTIGR4
serotype 4
D39
serotype 2
D39V
serotype 2
Hungary19A-6
serotype 19A
EF3030
serotype 19F
670-6B
serotype 6B
6A-10
serotype 6A
70585
serotype 5
A026
serotype 19F
A66
serotype 3
AP200
serotype 11A
ASP0581
serotype 12F
ATCC 49619
serotype 19F
ATCC 700669
serotype 23F
BM6001
serotype 19F
BVJ1JL
serotype 1
CGSP14
serotype 14
G54
serotype 19F
HU-OH
serotype 3
Hu15
serotype 19A
Hu17
serotype 19A
INV104
serotype 1
INV200
serotype 14
JJA
serotype 14
MDRSPN001
serotype 19F
NCTC7465
serotype 1
NCTC7466
serotype 2
NU83127
serotype 4
OXC141
serotype 3
P1031
serotype 1
R6
serotype 2
SP49
serotype 19A
SPN032672
serotype 1
SPN034156
serotype 3
SPN034183
serotype 3
SPN994038
serotype 3
SPN994039
serotype 3
SPNA45
serotype 3
ST556
serotype 19F
TCH8431/19A
serotype 19A
Taiwan19F-14
serotype 19F
Xen35
serotype 4
gamPNI0373
serotype 1

NCBI: 12-MAY-2020

Summary[edit | edit source]

  • organism: Streptococcus pneumoniae 6A-10
  • locus tag: HKM25_1983 [new locus tag: HKM25_RS12185 ]
  • pan locus tag?: PNEUPAN003521000
  • symbol: HKM25_1983
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: HKM25_1983 [new locus tag: HKM25_RS12185 ]
  • symbol: HKM25_1983
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1892792..1893646
  • length: 855
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: CP053210 (1892792..1893646) NCBI
  • BioCyc:
  • MicrobesOnline:
  • PneumoBrowse for strain D39V:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGGGCTTCCTTCTCGTGGGAGCACTCTTCATGGTTCTTCCCCGAACTATGGTCTCTGCT
    AAGCGGATTAATCAAGTTTTATATTTGCATTCTTCTATCCAAAACCCTGCTCAAGTGCAG
    CTGGCTGATGAAAACTTCAAAGGTCAGGTCGAGTTTAAGGATGTGACCTTCCGTTATGCG
    GCAAATTCGGAGGCAGTTATTGAACATGTTAGATTTAAAGCAGAAACTGGTCAAACAGTG
    GCCTTTATTGGGTCAACAGGTTCTGGTAAATCAACTCTGGTCAATCTGATTCCACGTTTC
    TACGACGTGTCAGCAGGAGAAATTCTGGTGGACGGTGTCAATGTTCAAGACTATGACTTC
    TCTGCGACAGCTCATGCTGGTCAAAAGGTTGCCATTGTTGGGCCGACTGGGGCTGGTAAG
    ACAACCATTGTCAATCTTTTGATGAAATTCTATGAGATTGATAAGGGAAGTATTCGCATT
    GATGGTGTGGATACCAAGGCTATGACGCGTTCAGAAGTGCATGATGCCTTTTCAATGGTC
    TTGCAGGATACCTGGCTCTTTGAAGGAACTATTCGAGACAATCTCATCTATAATCAAATA
    GGGATTAGTGATGAACGAATGATGGAAGCTAGTAAGGCTGTGGGAATTCACCACTTTATT
    ATGACCTTGCCAGATGGCTATGATACCATCTTGGATGACACCGTGACCTTGTCTGTAGGA
    CAAAAACAACTATTGACTATTGCTCGTGCCCTTCTTAAGGATGCACCGCTTTTGATTTTG
    GATGAGGCGACTTCTTCTGTTGACACACGGACAGAGGAATTGATCCAAAAAGCCATGGAC
    CGTTTGATGGAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    855

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: HKM25_1983 [new locus tag: HKM25_RS12185 ]
  • symbol: HKM25_1983
  • description: hypothetical protein
  • length: 284
  • theoretical pI: 4.88392
  • theoretical MW: 31284.7
  • GRAVY: 0.0535211

Function[edit | edit source]

  • TIGRFAM:
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 260.2)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 259.4)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 259.4)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 248.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 248.9)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 226.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 225.1)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 208.4)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 208.4)
    and 105 more
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 205.3)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 203.8)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 200.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 183.8)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 183.8)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 183.8)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 181.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 181.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 165.8)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 143.8)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 134.3)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 116)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 116)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 110.7)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 108.1)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 108)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 103)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 102.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 97.8)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 95.5)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 90.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 85.4)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 85.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 84.2)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 84.2)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 83.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 83.1)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 83)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 82.7)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 82)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 81.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 81.3)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 80.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 79.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 76.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 75)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 74.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 73.6)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 72.2)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 71.6)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 70.7)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 70.7)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 70.6)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 69.8)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 67.1)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 67.1)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 63.8)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 63.8)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 63.6)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 59.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 58.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 57.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 56.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 56.6)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 54.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 54.5)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 48.3)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 39.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 37.8)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 34.4)
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 28.4)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 27.6)
    Unknown function General GTP-binding protein HflX (TIGR03156; HMM-score: 27)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 26.6)
    type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 24.8)
    P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 23.8)
    Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 23.3)
    Genetic information processing Protein synthesis Other ribosome-associated GTPase EngA (TIGR03594; HMM-score: 22.5)
    Metabolism Energy metabolism Amino acids and amines ethanolamine utilization protein, EutP (TIGR02528; HMM-score: 21.7)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 21.5)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 21.3)
    Genetic information processing Protein synthesis Other GTP-binding protein Era (TIGR00436; HMM-score: 20.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A dephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 20.5)
    Cellular processes Cellular processes Conjugation P-type conjugative transfer ATPase TrbB (TIGR02782; HMM-score: 20.1)
    nicotinamide-nucleotide adenylyltransferase (TIGR01526; EC 2.7.7.1; HMM-score: 19)
    Metabolism Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 18.4)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 18)
    Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 17.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 17.5)
    Signal transduction Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 17.5)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 17.2)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 17.2)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions guanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 16.8)
    Genetic information processing Protein fate Protein modification and repair hydrogenase accessory protein HypB (TIGR00073; HMM-score: 16.6)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 16.5)
    Cellular processes Cellular processes Other gas vesicle protein GvpN (TIGR02640; HMM-score: 16)
    Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 15.9)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 15.7)
    type-IV secretion system protein TraC (TIGR02746; HMM-score: 15)
    flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 14.5)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions adenylate kinase (TIGR01351; EC 2.7.4.-; HMM-score: 14.4)
    Cellular processes Cellular processes Pathogenesis type III secretion apparatus H+-transporting two-sector ATPase (TIGR02546; EC 3.6.3.14; HMM-score: 14.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type III secretion apparatus H+-transporting two-sector ATPase (TIGR02546; EC 3.6.3.14; HMM-score: 14.2)
    Cell structure Cell envelope Surface structures twitching motility protein (TIGR01420; HMM-score: 14.1)
    Cellular processes Cellular processes Chemotaxis and motility twitching motility protein (TIGR01420; HMM-score: 14.1)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair orc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 14.1)
    Cellular processes Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 14.1)
    helicase/secretion neighborhood ATPase (TIGR03819; HMM-score: 13.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 12.9)
    Genetic information processing Protein fate Protein modification and repair [FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 12.7)
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent Clp protease, ATP-binding subunit ClpX (TIGR00382; HMM-score: 12)
    Genetic information processing Protein fate Protein folding and stabilization ATP-dependent Clp protease, ATP-binding subunit ClpX (TIGR00382; HMM-score: 12)
    type IV conjugative transfer system coupling protein TraD (TIGR02759; HMM-score: 11.7)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 11.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking putative secretion ATPase, PEP-CTERM locus subfamily (TIGR03015; HMM-score: 10)
  • TheSEED: data available for D39, Hungary19A-6, TIGR4
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 148.3)
    and 64 more
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 42.2)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 33.8)
    AAA_23; AAA domain (PF13476; HMM-score: 31.5)
    AAA_22; AAA domain (PF13401; HMM-score: 31.4)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 31.1)
    AAA_30; AAA domain (PF13604; HMM-score: 30.2)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 29.8)
    AAA_24; AAA domain (PF13479; HMM-score: 29.6)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 27.6)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 27.5)
    AAA_7; P-loop containing dynein motor region (PF12775; HMM-score: 26.5)
    DUF87; Helicase HerA, central domain (PF01935; HMM-score: 26.4)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 26.1)
    AAA_18; AAA domain (PF13238; HMM-score: 24.7)
    AAA_33; AAA domain (PF13671; HMM-score: 24.4)
    AAA_10; AAA-like domain (PF12846; HMM-score: 24.3)
    AAA_19; AAA domain (PF13245; HMM-score: 24.1)
    NTPase_1; NTPase (PF03266; HMM-score: 23.8)
    DEAD; DEAD/DEAH box helicase (PF00270; HMM-score: 23.2)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 23.1)
    Zeta_toxin; Zeta toxin (PF06414; HMM-score: 22.9)
    AAA_28; AAA domain (PF13521; HMM-score: 22.8)
    ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 22.6)
    Roc; Ras of Complex, Roc, domain of DAPkinase (PF08477; HMM-score: 22.6)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 22)
    ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 21.6)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 20.6)
    Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 20.2)
    Dynamin_N; Dynamin family (PF00350; HMM-score: 20)
    FtsK_SpoIIIE; FtsK/SpoIIIE family (PF01580; HMM-score: 19.7)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 19.6)
    MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 19.3)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 19.3)
    DUF5906; Family of unknown function (DUF5906) (PF19263; HMM-score: 19.1)
    AAA_14; AAA domain (PF13173; HMM-score: 18.8)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 18.7)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 18.4)
    DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 18.4)
    SRP54; SRP54-type protein, GTPase domain (PF00448; HMM-score: 18.2)
    dNK; Deoxynucleoside kinase (PF01712; HMM-score: 18.1)
    NACHT; NACHT domain (PF05729; HMM-score: 17.9)
    ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 17.7)
    P-loop_TraG; TraG P-loop domain (PF19044; HMM-score: 17.5)
    G-alpha; G-protein alpha subunit (PF00503; HMM-score: 17.2)
    TrwB_AAD_bind; Type IV secretion-system coupling protein DNA-binding domain (PF10412; HMM-score: 16.6)
    Septin; Septin (PF00735; HMM-score: 16.1)
    Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 15.9)
    PduV-EutP; Ethanolamine utilisation - propanediol utilisation (PF10662; HMM-score: 15.9)
    GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 15.3)
    FeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 15.3)
    RuvB_N; Holliday junction DNA helicase RuvB P-loop domain (PF05496; HMM-score: 15.2)
    IIGP; Interferon-inducible GTPase (IIGP) (PF05049; HMM-score: 14.7)
    AAA_17; AAA domain (PF13207; HMM-score: 14.6)
    APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 14.5)
    AAA_25; AAA domain (PF13481; HMM-score: 14.5)
    ResIII; Type III restriction enzyme, res subunit (PF04851; HMM-score: 14.3)
    Rad17; Rad17 P-loop domain (PF03215; HMM-score: 14.1)
    MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 13.7)
    TniB; Bacterial TniB protein (PF05621; HMM-score: 13.1)
    IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 13)
    DUF3584; Protein of unknown function (DUF3584) (PF12128; HMM-score: 12.8)
    SRPRB; Signal recognition particle receptor beta subunit (PF09439; HMM-score: 12.6)
    Pentapeptide (CL0505) Pentapeptide_4; Pentapeptide repeats (9 copies) (PF13599; HMM-score: 12.4)
    P-loop_NTPase (CL0023) Pox_A32; Poxvirus A32 protein (PF04665; HMM-score: 12.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.04
    • Cytoplasmic Membrane Score: 9.96
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0031
    • Cytoplasmic Membrane Score: 0.9872
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0093
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.456474
    • TAT(Tat/SPI): 0.014295
    • LIPO(Sec/SPII): 0.034305
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: QJS37664 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MGFLLVGALFMVLPRTMVSAKRINQVLYLHSSIQNPAQVQLADENFKGQVEFKDVTFRYAANSEAVIEHVRFKAETGQTVAFIGSTGSGKSTLVNLIPRFYDVSAGEILVDGVNVQDYDFSATAHAGQKVAIVGPTGAGKTTIVNLLMKFYEIDKGSIRIDGVDTKAMTRSEVHDAFSMVLQDTWLFEGTIRDNLIYNQIGISDERMMEASKAVGIHHFIMTLPDGYDTILDDTVTLSVGQKQLLTIARALLKDAPLLILDEATSSVDTRTEELIQKAMDRLME

Experimental data[edit | edit source]

  • protein localization:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Expression data[edit | edit source]

  • PneumoExpress for strain D39V:

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]