Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 28-AUG-2013
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TCH8431/19A
- locus tag: HMPREF0837_11496 [new locus tag: HMPREF0837_RS07160 ]
- pan locus tag?: PNEUPAN001992000
- symbol: HMPREF0837_11496
- pan gene symbol?: rocS
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: HMPREF0837_11496 [new locus tag: HMPREF0837_RS07160 ]
- symbol: HMPREF0837_11496
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1381259..1381750
- length: 492
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001993 (1381259..1381750) NCBI
- BioCyc: see HMPREF0837_RS07160
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0878 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAGTATTGAAATGACCGTCAGTGAGATTGCAGAGGTCTTAGGATTATCTCGCCAAGCA
ATCAATAACCGTGTCAAAGAATTACCAGAAGAAGACACAGATAAAAATGACAAAGGGGTA
ACAGTTGTTACCAGAAGTGGCTTGATTAAGCTAGAAGAAATCTATAAAAAAACGATTTTT
GAAGATGAGCCTGTCAGTGAAGATGTCAAACAACGTGAACTGATGGAGATTCTAGTGGAT
GAGAAGAATGCAGAAATTCTTCGTCTTTATGAACAATTAAAAGCCAAGGATCGTCAGTTA
TCAGAAAAAGACGAGCAGATGCGTATCAAAGACCGTCAGATTGCTGAGAAAGACAAACAA
TTAGATCAGCAACAACAATTGACCCTTCAAGCCATGAAGGATCAAGAAAATCTTAAGCTA
GAGCTGGACCAAGCAAAAGAAGAAGTCCAATCCACTAAAAAAGGCTTTTTTGCTCGTTTA
TTTGGAGGATAA60
120
180
240
300
360
420
480
492
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: HMPREF0837_11496 [new locus tag: HMPREF0837_RS07160 ]
- symbol: HMPREF0837_11496
- description: hypothetical protein
- length: 163
- theoretical pI: 4.58434
- theoretical MW: 18970.4
- GRAVY: -0.851534
⊟Function[edit | edit source]
- TIGRFAM: probable regulatory domain (TIGR03879; HMM-score: 16.1)Regulatory functions DNA interactions biotin operon repressor (TIGR00122; HMM-score: 15.4)Unknown function General DNA binding domain, excisionase family (TIGR01764; HMM-score: 14.6)and 4 moreRNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 12.5)RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 11)Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 10.2)Mobile and extrachromosomal element functions Plasmid functions integrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 6.5)
- TheSEED :
- Transcriptional regulator OrfX
- PFAM: no clan defined DUF536; Protein of unknown function, DUF536 (PF04394; HMM-score: 66.7)and 23 moreHTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23.6)MarR_2; MarR family (PF12802; HMM-score: 22.8)HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 21.5)DUF1323; Putative transcription regulator (DUF1323) (PF07037; HMM-score: 20.8)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 20.8)HTH_Mga; M protein trans-acting positive regulator (MGA) HTH domain (PF08280; HMM-score: 20.3)HTH_11; HTH domain (PF08279; HMM-score: 19.2)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 18.4)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 16.8)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 16.5)no clan defined FAM76; FAM76 protein (PF16046; HMM-score: 16.5)HTH (CL0123) Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 16.3)HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 15.2)MarR; MarR family (PF01047; HMM-score: 14.8)HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 14.5)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 13.2)HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 12.6)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 12.5)no clan defined RNase_Y_N; RNase Y N-terminal region (PF12072; HMM-score: 12.3)FAM60A; Protein Family FAM60A (PF15396; HMM-score: 9.8)Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 9.5)DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 7.6)TMEM131_like; Transmembrane protein 131-like (PF19532; HMM-score: 6.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9801
- Cytoplasmic Membrane Score: 0.0052
- Cell wall & surface Score: 0.0108
- Extracellular Score: 0.0038
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004489
- TAT(Tat/SPI): 0.000371
- LIPO(Sec/SPII): 0.001631
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ADI69724 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSIEMTVSEIAEVLGLSRQAINNRVKELPEEDTDKNDKGVTVVTRSGLIKLEEIYKKTIFEDEPVSEDVKQRELMEILVDEKNAEILRLYEQLKAKDRQLSEKDEQMRIKDRQIAEKDKQLDQQQQLTLQAMKDQENLKLELDQAKEEVQSTKKGFFARLFGG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0878 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]