Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 04-FEB-2016
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae INV104
- locus tag: INV104_01310 [new locus tag: INV104_RS00825 ]
- pan locus tag?: PNEUPAN000873000
- symbol: INV104_01310
- pan gene symbol?: —
- synonym:
- product: putative membrane protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: INV104_01310 [new locus tag: INV104_RS00825 ]
- symbol: INV104_01310
- product: putative membrane protein
- replicon: chromosome
- strand: +
- coordinates: 151769..152302
- length: 534
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312030 (151769..152302) NCBI
- BioCyc: see INV104_RS00825
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0159 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAAAAAGAAACCAATTTATCTATGGGTCTTGCTAATCTTGTCTGCCCTTATTTCAGTT
CCGTCTCTGTTTGGAATTGTGAGTCCCTTGCCTAGTAAAGAAGCCCTTCGTACTGCTCAG
AAACAAGTTGCAGGGGTCAATGCTCAGCAATTAGAAGACCAGCTTAATTATACCTATAGA
GTAGCAGAAGCATCTCATTCTATTTTTAATGTTGCTTTGATTGTGCTATCTACTATTTTA
GTGGTCGTAGCGATTGTCTTCCTTGTTCGTAAAAATTTGCAATATGCAAACTATACTTAC
GTTGGCTATGTTTTGTTAGCTATTATTGGTTCGATTTATGGCTATGTTGGTTTACAAGAC
GCTGTGCAGTTGGTTCAAGATGAGAGCATGCGTTTGACAGTGAGTATTGGTTCAAAAGCT
GTTAGCATTTTCTATATCGTCATCAATGTTCTCTTCCTAGCCCTTGTCTTCTATAAGATG
TGGCGACAACAGAAAGCCTCGGCAGAAGAAGAGGAAACAGAAGAGCTTGCCTAA60
120
180
240
300
360
420
480
534
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: INV104_01310 [new locus tag: INV104_RS00825 ]
- symbol: INV104_01310
- description: putative membrane protein
- length: 177
- theoretical pI: 8.67357
- theoretical MW: 19779.1
- GRAVY: 0.575706
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein folding and stabilization cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 5.6)Energy metabolism Electron transport cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 5.6)
- TheSEED :
- FIG01114268: hypothetical protein
- PFAM: no clan defined DUF3169; Protein of unknown function (DUF3169) (PF11368; HMM-score: 22.2)OSTbeta; Organic solute transporter subunit beta protein (PF15048; HMM-score: 19.4)and 24 moreDUF2157; Predicted membrane protein (DUF2157) (PF09925; HMM-score: 16.3)2heme_cytochrom (CL0328) DUF2231; Predicted membrane protein (DUF2231) (PF09990; HMM-score: 15.4)no clan defined DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 14.3)Baculo_11_kDa; Baculovirus 11 kDa family (PF06143; HMM-score: 14.3)DUF4052; Protein of unknown function (DUF4052) (PF13261; HMM-score: 14.1)TRP; Transient receptor potential (TRP) ion channel (PF06011; HMM-score: 13.5)DUF846; Eukaryotic protein of unknown function (DUF846) (PF05832; HMM-score: 12.5)GPCR_A (CL0192) Ceramidase; Ceramidase (PF05875; HMM-score: 12.3)no clan defined MAP17; Membrane-associated protein 117 kDa, PDZK1-interacting protein 1 (PF15807; HMM-score: 12.2)SKG6; SKG6 family (PF08693; HMM-score: 11.8)Trp_oprn_chp; Tryptophan-associated transmembrane protein (Trp_oprn_chp) (PF09534; HMM-score: 11.8)E1-E2_ATPase; E1-E2 ATPase (PF00122; HMM-score: 10.8)DUF3671; Protein of unknown function (PF12420; HMM-score: 9.9)PspB; Phage shock protein B (PF06667; HMM-score: 9.7)FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 9.6)EphA2_TM; Ephrin type-A receptor 2 transmembrane domain (PF14575; HMM-score: 9.1)Renin_r; Renin receptor-like protein (PF07850; HMM-score: 8.9)DUF202; Domain of unknown function (DUF202) (PF02656; HMM-score: 8.3)DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 8.2)DUF4083; Domain of unknown function (DUF4083) (PF13314; HMM-score: 7.6)Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 7.2)no clan defined DUF4282; Domain of unknown function (DUF4282) (PF14110; HMM-score: 7.1)Jagunal; Jagunal, ER re-organisation during oogenesis (PF07086; HMM-score: 6.9)Tetraspannin (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 6.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0003
- Cytoplasmic Membrane Score: 0.9075
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0916
- SignalP: Signal peptide SP(Sec/SPI) length 35 aa
- SP(Sec/SPI): 0.87104
- TAT(Tat/SPI): 0.023788
- LIPO(Sec/SPII): 0.035072
- Cleavage Site: CS pos: 35-36. KEA-LR. Pr: 0.1102
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CBW35815 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKKKPIYLWVLLILSALISVPSLFGIVSPLPSKEALRTAQKQVAGVNAQQLEDQLNYTYRVAEASHSIFNVALIVLSTILVVVAIVFLVRKNLQYANYTYVGYVLLAIIGSIYGYVGLQDAVQLVQDESMRLTVSIGSKAVSIFYIVINVLFLALVFYKMWRQQKASAEEEETEELA
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0159 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]