Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 11-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae INV104
- locus tag: INV104_RS10735 [old locus tag: INV104_18300 ]
- pan locus tag?: PNEUPAN003790000
- symbol: INV104_RS10735
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: INV104_RS10735 [old locus tag: INV104_18300 ]
- symbol: INV104_RS10735
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2013809..2014276
- length: 468
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_017591 (2013809..2014276) NCBI
- BioCyc: INV104_RS10735 BioCyc
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1948 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGATAGATAAACTGGTCAGTAACCTACTCCTGACCTTTTTCTTTTGCAAAATGACAAAA
ATCATAAACTTTTTGACAACTATACTTGTCAAAAAGAAAAAGATGTGTTACAATGAATTC
AAGTTAAGAAATAGGAAGCAGAAAGGAGTTATAATGTGGGTACTAGTATTTATACTATTT
ATGATTTTCTTTTATTCTAATAATTCTAAAAAAATCAAGAAACTAGAGAATAAAATCAAA
AAACTTGAGCGAAAAGAGAAAGGAAACGCAGAAATGTCGAGATTATTGCAAGAAATGATT
GGAAAGGAACCAATTATAACGGGAGTGTATATTGGGCCAGATAACTGGGAAGTTGTGGAT
GTTGATGAGGAATGGGTAAAGCTACGACGTGTAGATAATACGGGAAAAGAAAAATTCAAG
TTGCAACGCATTGAGGATATCCAAACCGTTGAATTTGACGGAGAGTAG60
120
180
240
300
360
420
468
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: INV104_RS10735 [old locus tag: INV104_18300 ]
- symbol: INV104_RS10735
- description: hypothetical protein
- length: 155
- theoretical pI: 10.2486
- theoretical MW: 18551
- GRAVY: -0.274194
⊟Function[edit | edit source]
- TIGRFAM: TIGR03943 family protein (TIGR03943; HMM-score: 11.6)Unknown function General TIGR00374 family protein (TIGR00374; HMM-score: 11.3)
- TheSEED: see INV104_18300
- PFAM: no clan defined LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 17.6)DUF2304; Uncharacterized conserved protein (DUF2304) (PF10066; HMM-score: 17.1)O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 15.9)TPR (CL0020) DUF6377; Domain of unknown function (DUF6377) (PF19904; HMM-score: 15.5)no clan defined DUF4446; Protein of unknown function (DUF4446) (PF14584; HMM-score: 15.1)AgrB; Accessory gene regulator B (PF04647; HMM-score: 14.1)and 6 moreYajC; Preprotein translocase subunit (PF02699; HMM-score: 13.8)PspB; Phage shock protein B (PF06667; HMM-score: 12.6)BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 12.5)DUF2615; Protein of unknown function (DUF2615) (PF11027; HMM-score: 12.1)ABC-2 (CL0181) ABC2_membrane_2; ABC-2 family transporter protein (PF12679; HMM-score: 11.6)no clan defined Ycf70; Uncharacterized Ycf70-like (PF17382; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0037
- Cytoplasmic Membrane Score: 0.726
- Cell wall & surface Score: 0.0019
- Extracellular Score: 0.2683
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009429
- TAT(Tat/SPI): 0.00025
- LIPO(Sec/SPII): 0.059901
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000565869 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIDKLVSNLLLTFFFCKMTKIINFLTTILVKKKKMCYNEFKLRNRKQKGVIMWVLVFILFMIFFYSNNSKKIKKLENKIKKLERKEKGNAEMSRLLQEMIGKEPIITGVYIGPDNWEVVDVDEEWVKLRRVDNTGKEKFKLQRIEDIQTVEFDGE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1948 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]