Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 670-6B
- locus tag: SP670_0777 [new locus tag: SP670_RS03875 ]
- pan locus tag?: PNEUPAN001650000
- symbol: SP670_0777
- pan gene symbol?: cupA
- synonym:
- product: conserved hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP670_0777 [new locus tag: SP670_RS03875 ]
- symbol: SP670_0777
- product: conserved hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 733433..733804
- length: 372
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP002176 (733433..733804) NCBI
- BioCyc: see SP670_RS03875
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0634 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTAAATAGTATTGTAACCATTATTTGTATTGCCCTTATCGCGTTTATCTTGTTTTGG
TTTTTCAAAAAGCCTGAAAAATCTGAACAAAAAGCCCAGCAAAAAAACGGATACCAAGAG
ATTCGAGTGGAAGTCATGGGAGGCTATACTCCTGAGTTGATTGTCCTCAAGAAATCAGTG
CCAGCACGCATTGTCTTTGACCGCAAGGATCCTTCACCATGTCTGGATCAAATTGTTTTT
CCAGATTTTGGTGTACATGCGAACCTGCCAATGGGGGAAGAGTATGTAGTGGAAATCACG
CCTGAACAGGCTGGAGAGTTTGGCTTTGCTTGTGGTATGAACATGATGCACGGCAAGATG
ATTGTAGAGTAG60
120
180
240
300
360
372
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP670_0777 [new locus tag: SP670_RS03875 ]
- symbol: SP670_0777
- description: conserved hypothetical protein
- length: 123
- theoretical pI: 5.17066
- theoretical MW: 13928.3
- GRAVY: 0.133333
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport nitrosocyanin (TIGR03096; HMM-score: 16)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter periplasmic protein LptC (TIGR04409; HMM-score: 13.5)Transport and binding proteins Other LPS export ABC transporter periplasmic protein LptC (TIGR04409; HMM-score: 13.5)and 1 moreEnergy metabolism Electron transport cytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 12.2)
- TheSEED :
- Copper-exporting ATPase (EC 3.6.3.4)
- PFAM: CU_oxidase (CL0026) Cupredoxin_1; Cupredoxin-like domain (PF13473; HMM-score: 81.8)and 5 moreno clan defined Chordopox_A13L; Chordopoxvirus A13L protein (PF05961; HMM-score: 16.5)FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 13.2)DUF4330; Domain of unknown function (DUF4330) (PF14221; HMM-score: 13.2)Saf_2TM; SAVED-fused 2TM effector domain (PF18303; HMM-score: 12.2)ABC-2 (CL0181) ABC_export; Putative ABC exporter (PF16962; HMM-score: 11)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.9355
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0642
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.153155
- TAT(Tat/SPI): 0.002465
- LIPO(Sec/SPII): 0.011372
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ADM90845 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLNSIVTIICIALIAFILFWFFKKPEKSEQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFGFACGMNMMHGKMIVE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0634 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]