Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 70585
- locus tag: SP70585_2077 [new locus tag: SP70585_RS10320 ]
- pan locus tag?: PNEUPAN003625000
- symbol: SP70585_2077
- pan gene symbol?: —
- synonym:
- product: conserved hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP70585_2077 [new locus tag: SP70585_RS10320 ]
- symbol: SP70585_2077
- product: conserved hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1911851..1912045
- length: 195
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000918 (1911851..1912045) NCBI
- BioCyc: see SP70585_RS10320
- MicrobesOnline: 7477996 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1802 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAGAAAGGGATCATCTATTTCTTTATCGGCCTGTCACTCTTGGTATGGTTAGTGGAA
ATGTTTACTGATTGGTTTGATCAAGCCTTGCTTCGCCAATTCATTCGTGGTGCTTTGGGG
TTTGGATTTATGATTTTCGTCGTTTTCCTTATGGGAATGGAGTGGTTGAAAGGAGAGTCT
CATGACGGTGGTTAA60
120
180
195
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP70585_2077 [new locus tag: SP70585_RS10320 ]
- symbol: SP70585_2077
- description: conserved hypothetical protein
- length: 64
- theoretical pI: 5.68244
- theoretical MW: 7454.9
- GRAVY: 0.78125
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General integral membrane protein (TIGR03954; HMM-score: 15.5)
- TheSEED :
- FIG01114205: hypothetical protein
- PFAM: LysE (CL0292) Colicin_V; Colicin V production protein (PF02674; HMM-score: 18)and 2 moreno clan defined DUF6249; Domain of unknown function (DUF6249) (PF19762; HMM-score: 9.2)TMEM43; Transmembrane protein 43 (PF07787; HMM-score: 7.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9992
- Cell wall & surface Score: 0
- Extracellular Score: 0.0008
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005164
- TAT(Tat/SPI): 0.000174
- LIPO(Sec/SPII): 0.009243
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKGIIYFFIGLSLLVWLVEMFTDWFDQALLRQFIRGALGFGFMIFVVFLMGMEWLKGESHDGG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1802 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]