Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 15-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 70585
- locus tag: SP70585_RS06760 [old locus tag: SP70585_1361 ]
- pan locus tag?: PNEUPAN002591000
- symbol: SP70585_RS06760
- pan gene symbol?: aroH
- synonym:
- product: chorismate mutase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP70585_RS06760 [old locus tag: SP70585_1361 ]
- symbol: SP70585_RS06760
- product: chorismate mutase
- replicon: chromosome
- strand: -
- coordinates: 1262942..1263208
- length: 267
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_012468 (1262942..1263208) NCBI
- BioCyc: SP70585_RS06760 BioCyc
- MicrobesOnline: see SP70585_1361
- PneumoBrowse for strain D39V: SPV_1151 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGATTTAGATATTATTCGTCAAGAAATCGATCAAATCGACGACCAAATTGTCAAACTG
TTAGAAGAACGAATGCATTTAGTTGAGGGGGTGGTTGCTTATAAGAAAGTTTCAGGTAAA
CCGATTTTAGATACTAAGAGAGAAGAAGTTATTTTTGAAAAGGTTAGGAGTCGTGTAGAG
GACAAGCGCTATCAGGAGACTATTGTCGCGACTTTTTCGGACATACTCAAACGTTCGCGT
GATTATCAGGATCAAAATATCAAATGA60
120
180
240
267
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP70585_RS06760 [old locus tag: SP70585_1361 ]
- symbol: SP70585_RS06760
- description: chorismate mutase
- length: 88
- theoretical pI: 5.24614
- theoretical MW: 10508
- GRAVY: -0.6625
⊟Function[edit | edit source]
- reaction: EC 5.4.99.5? ExPASyChorismate mutase Chorismate = prephenate
- TIGRFAM: Amino acid biosynthesis Aromatic amino acid family chorismate mutase (TIGR01805; EC 5.4.99.5; HMM-score: 124.3)and 10 moreAmino acid biosynthesis Aromatic amino acid family chorismate mutase (TIGR01791; EC 5.4.99.5; HMM-score: 49.7)Amino acid biosynthesis Aromatic amino acid family chorismate mutase (TIGR01797; EC 5.4.99.5; HMM-score: 39.3)Amino acid biosynthesis Aromatic amino acid family chorismate mutase (TIGR01801; EC 5.4.99.5; HMM-score: 38.6)Amino acid biosynthesis Aromatic amino acid family putative chorismate mutase (TIGR01806; EC 5.4.99.5; HMM-score: 38.1)Amino acid biosynthesis Aromatic amino acid family chorismate mutase (TIGR01807; EC 5.4.99.5; HMM-score: 36.9)Amino acid biosynthesis Aromatic amino acid family chorismate mutase (TIGR01808; EC 5.4.99.5; HMM-score: 36.4)Amino acid biosynthesis Aromatic amino acid family chorismate mutase (TIGR01799; EC 5.4.99.5; HMM-score: 33.9)Amino acid biosynthesis Aromatic amino acid family chorismate mutase (TIGR01795; EC 5.4.99.5; HMM-score: 29)chorismate mutase related enzymes (TIGR01803; HMM-score: 26.9)CRISPR type III-A/MTUBE-associated protein Csm2 (TIGR01870; HMM-score: 19.9)
- TheSEED: see SP70585_1361
- PFAM: no clan defined CM_2; Chorismate mutase type II (PF01817; HMM-score: 74.9)and 2 moreBEN; BEN domain (PF10523; HMM-score: 14.6)Osmo_CC; Osmosensory transporter coiled coil (PF08946; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9955
- Cytoplasmic Membrane Score: 0.0007
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.003
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001966
- TAT(Tat/SPI): 0.000505
- LIPO(Sec/SPII): 0.00042
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000362443 NCBI
- UniProt: see SP70585_1361
⊟Protein sequence[edit | edit source]
- MDLDIIRQEIDQIDDQIVKLLEERMHLVEGVVAYKKVSGKPILDTKREEVIFEKVRSRVEDKRYQETIVATFSDILKRSRDYQDQNIK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1151 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]