Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 02-FEB-2021
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae D39
- locus tag: SPD_RS00735 [old locus tag: SPD_0132 ]
- pan locus tag?: PNEUPAN000824000
- symbol: cibB
- pan gene symbol?: cibB
- synonym:
- product: fratricide two-peptide bacteriocin subunit CibB
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPD_RS00735 [old locus tag: SPD_0132 ]
- symbol: cibB
- product: fratricide two-peptide bacteriocin subunit CibB
- replicon: chromosome
- strand: -
- coordinates: 137368..137520
- length: 153
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_008533 (137368..137520) NCBI
- BioCyc: G1G6V-150 BioCyc
- MicrobesOnline: see SPD_0132
- PneumoBrowse for strain D39V: SPV_0132 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGATGAAAAATTTGAACAACTATCGTGAAATTTCTAATAAGGAATTGCAAGAAATCAAG
GGTGGCTTTGGTGTAGGTGTTGGTATCGCTTTATTTATGGCAGGTTATACCATTGGAAAA
GACCTTCGTAAAAAGTTTGGTAAGTCATGCTAG60
120
153
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPD_RS00735 [old locus tag: SPD_0132 ]
- symbol: CibB
- description: fratricide two-peptide bacteriocin subunit CibB
- length: 50
- theoretical pI: 10.3274
- theoretical MW: 5556.54
- GRAVY: -0.282
⊟Function[edit | edit source]
- TIGRFAM: class IIb bacteriocin, lactobin A/cerein 7B family (TIGR03949; HMM-score: 19.1)bacteriocin-type signal sequence (TIGR01847; HMM-score: 18.4)and 1 moreCellular processes Biosynthesis of natural products natural product precursor, GG-Bacteroidales family (TIGR04149; HMM-score: 13.4)
- TheSEED: see SPD_0132
- PFAM: GG-leader (CL0400) ComC; COMC family (PF03047; HMM-score: 24.1)Bacteriocin_IIc; Bacteriocin class II with double-glycine leader peptide (PF10439; HMM-score: 20.9)and 3 moreLactococcin; Lactococcin-like family (PF04369; HMM-score: 15.3)no clan defined DUF5841; Family of unknown function (DUF5841) (PF19159; HMM-score: 14.1)GG-leader (CL0400) L_biotic_typeA; Type-A lantibiotic (PF04604; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helix: 1
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.161508
- TAT(Tat/SPI): 0.009079
- LIPO(Sec/SPII): 0.074357
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMKNLNNYREISNKELQEIKGGFGVGVGIALFMAGYTIGKDLRKKFGKSC
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: ComX1 see SPD_0132
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0132 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.