Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 10-MAR-2021
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hungary19A-6
- locus tag: SPH_RS01150 [old locus tag: SPH_0240 ]
- pan locus tag?: PNEUPAN000824000
- symbol: cibB
- pan gene symbol?: cibB
- synonym:
- product: fratricide two-peptide bacteriocin subunit CibB
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPH_RS01150 [old locus tag: SPH_0240 ]
- symbol: cibB
- product: fratricide two-peptide bacteriocin subunit CibB
- replicon: chromosome
- strand: -
- coordinates: 210477..210629
- length: 153
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_010380 (210477..210629) NCBI
- BioCyc: SPH_RS01150 BioCyc
- MicrobesOnline: see SPH_0240
- PneumoBrowse for strain D39V: SPV_0132 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGATGAAAGATTTGAACAATTATCGTGAAATTTCTAATAAGGAATTGCAAGAAATCAAG
GGTGGCTTTGGTGTCGGTGTTGGTATCGCTTTATTTATGGCAGGTTATACCATTGGAAAA
GACCTTCGTAAAAAGTTTGGTAAGTCATGCTAG60
120
153
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPH_RS01150 [old locus tag: SPH_0240 ]
- symbol: CibB
- description: fratricide two-peptide bacteriocin subunit CibB
- length: 50
- theoretical pI: 10.0662
- theoretical MW: 5557.52
- GRAVY: -0.282
⊟Function[edit | edit source]
- TIGRFAM: class IIb bacteriocin, lactobin A/cerein 7B family (TIGR03949; HMM-score: 19)bacteriocin-type signal sequence (TIGR01847; HMM-score: 18.3)
- TheSEED: see SPH_0240
- PFAM: GG-leader (CL0400) ComC; COMC family (PF03047; HMM-score: 21.6)Bacteriocin_IIc; Bacteriocin class II with double-glycine leader peptide (PF10439; HMM-score: 20.9)and 1 moreLactococcin; Lactococcin-like family (PF04369; HMM-score: 14.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helix: 1
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.152209
- TAT(Tat/SPI): 0.01067
- LIPO(Sec/SPII): 0.068644
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMKDLNNYREISNKELQEIKGGFGVGVGIALFMAGYTIGKDLRKKFGKSC
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0132 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.