Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 24-APR-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae G54
- locus tag: SPG_RS00990 [old locus tag: SPG_0192 ]
- pan locus tag?: PNEUPAN000935000
- symbol: nrdG
- pan gene symbol?: nrdG
- synonym:
- product: anaerobic ribonucleoside-triphosphate reductase activating protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPG_RS00990 [old locus tag: SPG_0192 ]
- symbol: nrdG
- product: anaerobic ribonucleoside-triphosphate reductase activating protein
- replicon: chromosome
- strand: +
- coordinates: 191157..191747
- length: 591
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_011072 (191157..191747) NCBI
- BioCyc: SPG_RS00990 BioCyc
- MicrobesOnline: see SPG_0192
- PneumoBrowse for strain D39V: SPV_0190 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAATAATCCAAAACCACAAGAATGGAAAAGCGAGGAACTTAGTCAAGGTCGTATCATT
GACTACAAGGCCTTTAACTTTGTTGATGGCGAAGGCGTGCGTAACTCTCTCTATGTAGCA
GGCTGTATGTTTCACTGCGAGGGATGTTATAATGTTGCGACTTGGTCTTTTAATGCTGGC
ATTCCCTATACAGCAGAATTAGAAGAGCAGATCATGGCAGACCTTGCCCAACCCTATGTT
CAAGGCTTGACTTTGCTGGGAGGGGAACCTTTTCTCAATACTGGCATTCTCTTGCCTCTA
GTTAAACGCATCCGAAAGGAATTGTCAGACAAGGACATTTGGTCCTGGACGGGCTACACT
TGGGAAGAAATGATGTTGGAAACTCCAGATAAACTGGAACTCTTATCATTGATTGACATT
CTTGTCGATGGACGATACGATCGAACTAAGAGAAATCTCATGCTCCAGTTTCGAGGTTCG
TCCAACCAACGAATTATCGATGTGCAAAAATCGCTCAAAAGTGGGCAAGTAGTGATTTGG
GACAAGCTCAATGACGGAAAAGAAAGCTATGAACAGGTGAAGAGAGAATGA60
120
180
240
300
360
420
480
540
591
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPG_RS00990 [old locus tag: SPG_0192 ]
- symbol: NrdG
- description: anaerobic ribonucleoside-triphosphate reductase activating protein
- length: 196
- theoretical pI: 4.71159
- theoretical MW: 22608.6
- GRAVY: -0.441327
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 196.7)Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 196.7)and 14 morePurines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02826; EC 1.97.1.-; HMM-score: 49.5)Protein fate Protein modification and repair pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 48.1)Energy metabolism Anaerobic pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 48.1)glycyl-radical enzyme activating protein (TIGR02494; EC 1.97.1.-; HMM-score: 34.8)Protein fate Protein modification and repair glycine radical enzyme activase, YjjW family (TIGR04041; EC 1.97.1.-; HMM-score: 34)Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 27.1)Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 27.1)Protein synthesis tRNA and rRNA base modification putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03963; HMM-score: 22.6)Energy metabolism Amino acids and amines choline TMA-lyase-activating enzyme (TIGR04395; EC 1.97.-.-; HMM-score: 21.9)Protein fate Protein modification and repair [benzylsuccinate synthase]-activating enzyme (TIGR04003; EC 1.97.-.-; HMM-score: 17.1)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin heme d1 biosynthesis radical SAM protein NirJ (TIGR04051; HMM-score: 14.4)putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04349; HMM-score: 12.8)His-Xaa-Ser system radical SAM maturase HxsC (TIGR03977; HMM-score: 11.2)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin putative heme d1 biosynthesis radical SAM protein NirJ1 (TIGR04054; HMM-score: 10.8)
- TheSEED: see SPG_0192
- PFAM: 4Fe-4S (CL0344) Fer4_12; 4Fe-4S single cluster domain (PF13353; HMM-score: 171.1)and 2 moreFer4_14; 4Fe-4S single cluster domain (PF13394; HMM-score: 101.5)TIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 24.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9523
- Cytoplasmic Membrane Score: 0.0125
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0349
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.245472
- TAT(Tat/SPI): 0.001174
- LIPO(Sec/SPII): 0.003251
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001064210 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVAGCMFHCEGCYNVATWSFNAGIPYTAELEEQIMADLAQPYVQGLTLLGGEPFLNTGILLPLVKRIRKELSDKDIWSWTGYTWEEMMLETPDKLELLSLIDILVDGRYDRTKRNLMLQFRGSSNQRIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: nrdD > SPG_RS00980 > SPG_RS00985 > nrdG > SPG_RS00995
⊟Regulation[edit | edit source]
- regulator: NrdR* see SPG_0192
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0190 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]