Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 24-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hungary19A-6
- locus tag: SPH_RS01540 [old locus tag: SPH_0320 ]
- pan locus tag?: PNEUPAN000935000
- symbol: nrdG
- pan gene symbol?: nrdG
- synonym:
- product: anaerobic ribonucleoside-triphosphate reductase activating protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPH_RS01540 [old locus tag: SPH_0320 ]
- symbol: nrdG
- product: anaerobic ribonucleoside-triphosphate reductase activating protein
- replicon: chromosome
- strand: +
- coordinates: 281808..282398
- length: 591
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_010380 (281808..282398) NCBI
- BioCyc: SPH_RS01540 BioCyc
- MicrobesOnline: see SPH_0320
- PneumoBrowse for strain D39V: SPV_0190 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAATAATCCAAAACCACAAGAATGGAAAAGCGAGGAACTTAGTCAAGGTCGTATCATT
GACTACAAGGCCTTTAACTTTGTGGACGGCGAAGGCGTGCGCAACTCTCTCTATGTATCA
GGCTGTATGTTTCACTGCGAGGGATGTTATAATGTTGCGACTTGGTCTTTTAATGCTGGC
ATTCCCTATACAGCAGAATTAGAAGAGCAGATCATGGCAGACCTTGCCCAACCCTATGTT
CAAGGCTTGACTTTGCTGGGAGGGGAACCTTTTCTCAATACTGGCATTCTCTTGCCTCTA
GTTAAACGCATCCGAAAGGAATTGTCAGACAAGGACATTTGGTCCTGGACGGGCTACACT
TGGGAAGAAATGATGTTGGAAACTCCAGATAAACTGGAACTCTTATCATTGATTGACATT
CTTGTCGATGGACGATACGATCGAACTAAGAGAAATCTCATGCTCCAGTTTCGAGGTTCG
TCCAACCAACGAATTATCGATGTGCAAAAATCGCTCAAAAGTGGGCAAGTAGTGATTTGG
GACAAGCTCAATGACGGAAAAGAAAGCTATGAACAGGTGAAGAGAGAATGA60
120
180
240
300
360
420
480
540
591
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPH_RS01540 [old locus tag: SPH_0320 ]
- symbol: NrdG
- description: anaerobic ribonucleoside-triphosphate reductase activating protein
- length: 196
- theoretical pI: 4.71159
- theoretical MW: 22624.6
- GRAVY: -0.454592
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 196.4)Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 196.4)and 14 morePurines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02826; EC 1.97.1.-; HMM-score: 50.7)Protein fate Protein modification and repair pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 48.8)Energy metabolism Anaerobic pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 48.8)glycyl-radical enzyme activating protein (TIGR02494; EC 1.97.1.-; HMM-score: 35)Protein fate Protein modification and repair glycine radical enzyme activase, YjjW family (TIGR04041; EC 1.97.1.-; HMM-score: 34.1)Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 28)Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 28)Protein synthesis tRNA and rRNA base modification putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03963; HMM-score: 22.3)Energy metabolism Amino acids and amines choline TMA-lyase-activating enzyme (TIGR04395; EC 1.97.-.-; HMM-score: 22.1)Protein fate Protein modification and repair [benzylsuccinate synthase]-activating enzyme (TIGR04003; EC 1.97.-.-; HMM-score: 17.3)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin heme d1 biosynthesis radical SAM protein NirJ (TIGR04051; HMM-score: 14.5)putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04349; HMM-score: 12.6)His-Xaa-Ser system radical SAM maturase HxsC (TIGR03977; HMM-score: 11.2)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin putative heme d1 biosynthesis radical SAM protein NirJ1 (TIGR04054; HMM-score: 10.9)
- TheSEED: see SPH_0320
- PFAM: 4Fe-4S (CL0344) Fer4_12; 4Fe-4S single cluster domain (PF13353; HMM-score: 171.8)and 2 moreFer4_14; 4Fe-4S single cluster domain (PF13394; HMM-score: 101.9)TIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 24.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9532
- Cytoplasmic Membrane Score: 0.0124
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0341
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.249824
- TAT(Tat/SPI): 0.001033
- LIPO(Sec/SPII): 0.004118
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVSGCMFHCEGCYNVATWSFNAGIPYTAELEEQIMADLAQPYVQGLTLLGGEPFLNTGILLPLVKRIRKELSDKDIWSWTGYTWEEMMLETPDKLELLSLIDILVDGRYDRTKRNLMLQFRGSSNQRIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SPH_RS01520 > nrdD > SPH_RS01530 > SPH_RS01535 > nrdG > SPH_RS01545
⊟Regulation[edit | edit source]
- regulator: NrdR see SPH_0320
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0190 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]