Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hungary19A-6
- locus tag: SPH_1542 [new locus tag: SPH_RS07455 ]
- pan locus tag?: PNEUPAN002686000
- symbol: SPH_1542
- pan gene symbol?: —
- synonym:
- product: conserved hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPH_1542 [new locus tag: SPH_RS07455 ]
- symbol: SPH_1542
- product: conserved hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1426698..1427081
- length: 384
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000936 (1426698..1427081) NCBI
- BioCyc: see SPH_RS07455
- MicrobesOnline: 5696370 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1242 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTAGAAGTTGCATATATTCTTGTTGCCCTAGCTTTGATTGTCTTTTTGGTCTATCTA
ATCATTACTGTACAAAAGCTTGGTCGTGTCATCGATGAAACAGAAAAGACGATTAAAACC
TTGACTTCAGATGTGGATGTGACCTTGCATCACACCAATGAGTTGTTGGCTAAGGTCAAT
GTCTTGGCAGATGATATCAATGTCAAGGTGGCTACGATTGATCCACTCTTCAGTGCTGTT
GCAGATTTATCTCTATCTGTTTCAGACCTCAATGACCATGCGCGTGTCTTGAGCAAGAAA
GCTTCATCAGCTGGTTCAAAAACACTCAAGACTGGTGCAAGTCTGTCAGCTCTTCGTCTT
GCAAGTAAATTTTTCAAAAAATAA60
120
180
240
300
360
384
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPH_1542 [new locus tag: SPH_RS07455 ]
- symbol: SPH_1542
- description: conserved hypothetical protein
- length: 127
- theoretical pI: 9.55892
- theoretical MW: 13707
- GRAVY: 0.489764
⊟Function[edit | edit source]
- TIGRFAM: integral membrane protein (TIGR04561; HMM-score: 15.1)heavy metal sensor kinase (TIGR01386; EC 2.7.13.3; HMM-score: 14.9)
- TheSEED :
- General stress protein
- PFAM: no clan defined DUF948; Bacterial protein of unknown function (DUF948) (PF06103; HMM-score: 88.5)and 7 moreBORCS7; BLOC-1-related complex sub-unit 7 (PF16088; HMM-score: 16.9)Laminin_II; Laminin Domain II (PF06009; HMM-score: 15.5)TPR (CL0020) DUF6377; Domain of unknown function (DUF6377) (PF19904; HMM-score: 15.3)no clan defined BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 13.9)Effector_1; Effector from type III secretion system (PF04518; HMM-score: 13)FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 12.7)OML_zippers (CL0590) LPP; Lipoprotein leucine-zipper (PF04728; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9969
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0029
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.032626
- TAT(Tat/SPI): 0.000341
- LIPO(Sec/SPII): 0.005092
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLEVAYILVALALIVFLVYLIITVQKLGRVIDETEKTIKTLTSDVDVTLHHTNELLAKVNVLADDINVKVATIDPLFSAVADLSLSVSDLNDHARVLSKKASSAGSKTLKTGASLSALRLASKFFKK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1242 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]