Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 24-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hungary19A-6
- locus tag: SPH_RS12650
- pan locus tag?: PNEUPAN002559000
- symbol: SPH_RS12650
- pan gene symbol?: —
- synonym:
- product: cysteine-rich KTR domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPH_RS12650
- symbol: SPH_RS12650
- product: cysteine-rich KTR domain-containing protein
- replicon: chromosome
- strand: -
- coordinates: 1305739..1305906
- length: 168
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121TTGTGTCCTGTATGTGGAAATAAAACACGATTAAAGATAAGGGAAGATACTGAATTAAAA
AAATTCCCCCTCTATTGTCCGAAATGCAGACAAGAAAATTTAATTGAAATAAAGCAGTTC
AAAGTAACTGTGATTACAGAGCCAGACGCAAAGACGCAGAGCCGATAA60
120
168
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPH_RS12650
- symbol: SPH_RS12650
- description: cysteine-rich KTR domain-containing protein
- length: 55
- theoretical pI: 9.44942
- theoretical MW: 6469.64
- GRAVY: -0.7
⊟Function[edit | edit source]
- TIGRFAM: cxxc_20_cxxc protein (TIGR04104; HMM-score: 14.8)YgiT-type zinc finger domain (TIGR03831; HMM-score: 14.1)Mobile and extrachromosomal element functions Prophage functions restriction alleviation protein, Lar family (TIGR03655; HMM-score: 13.6)DNA metabolism Restriction/modification restriction alleviation protein, Lar family (TIGR03655; HMM-score: 13.6)Regulatory functions DNA interactions putative regulatory protein, FmdB family (TIGR02605; HMM-score: 12.4)
- TheSEED:
- PFAM: no clan defined Cys_rich_KTR; Cysteine-rich KTR (PF14205; HMM-score: 102.5)and 24 moreZn_Beta_Ribbon (CL0167) Zn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 18.6)Elf1; Transcription elongation factor Elf1 like (PF05129; HMM-score: 18.5)zf-TFIIB; Transcription factor zinc-finger (PF13453; HMM-score: 18.5)Nudix_N_2; Nudix N-terminal (PF14803; HMM-score: 17.9)zf-ISL3; zinc-finger of transposase IS204/IS1001/IS1096/IS1165 (PF14690; HMM-score: 17.6)no clan defined zf-IS66; zinc-finger binding domain of transposase IS66 (PF13005; HMM-score: 16.6)Zn_Beta_Ribbon (CL0167) NOB1_Zn_bind; Nin one binding (NOB1) Zn-ribbon like (PF08772; HMM-score: 16.2)no clan defined Cys_rich_CPXG; Cysteine-rich CPXCG (PF14255; HMM-score: 15.6)Zn_Beta_Ribbon (CL0167) Zn_ribbon_SprT; SprT-like zinc ribbon domain (PF17283; HMM-score: 15.5)zf-NADH-PPase; NADH pyrophosphatase zinc ribbon domain (PF09297; HMM-score: 15)Lar_restr_allev; Restriction alleviation protein Lar (PF14354; HMM-score: 14.6)no clan defined DNA_ligase_ZBD; NAD-dependent DNA ligase C4 zinc finger domain (PF03119; HMM-score: 14.5)Zn_Beta_Ribbon (CL0167) Prim_Zn_Ribbon; Zinc-binding domain of primase-helicase (PF08273; HMM-score: 13.8)zinc_ribbon_2; zinc-ribbon domain (PF13240; HMM-score: 13.8)TF_Zn_Ribbon; TFIIB zinc-binding (PF08271; HMM-score: 13.7)no clan defined HypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 13.6)Zn_Beta_Ribbon (CL0167) DZR; Double zinc ribbon (PF12773; HMM-score: 13.1)CpXC; CpXC protein (PF14353; HMM-score: 12.3)TFIIS_C; Transcription factor S-II (TFIIS) (PF01096; HMM-score: 12.2)no clan defined zf-LITAF-like; LITAF-like zinc ribbon domain (PF10601; HMM-score: 12.2)C2H2-zf (CL0361) zf-H2C2_2; Zinc-finger double domain (PF13465; HMM-score: 11.8)no clan defined DUF5679; Domain of unknown function (DUF5679) (PF18930; HMM-score: 11.8)DUF3797; Domain of unknown function (DUF3797) (PF12677; HMM-score: 11.1)Zn_Beta_Ribbon (CL0167) Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 10.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9665
- Cytoplasmic Membrane Score: 0.0202
- Cell wall & surface Score: 0.0012
- Extracellular Score: 0.0121
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.01485
- TAT(Tat/SPI): 0.001236
- LIPO(Sec/SPII): 0.01145
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000336323 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MCPVCGNKTRLKIREDTELKKFPLYCPKCRQENLIEIKQFKVTVITEPDAKTQSR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]