Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 26-AUG-2017
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPN034183
- locus tag: SPN034183_00140 [new locus tag: SPN034183_RS00070 ]
- pan locus tag?: PNEUPAN000089000
- symbol: comX
- pan gene symbol?: comX1
- synonym:
- product: putative competence-specific global transcription modulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN034183_00140 [new locus tag: SPN034183_RS00070 ]
- symbol: comX
- product: putative competence-specific global transcription modulator
- replicon: chromosome
- strand: +
- coordinates: 14439..14918
- length: 480
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312043 (14439..14918) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0014 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTGTATAAGTGTAGAAATGAATAT
TACCTTCATTTATGGGAATTGTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAA
TTGATTAGTAGAGAAGAAGGACTGGCAGACGATATTCCACGTTTAAGGAAATATTTCAAA
ACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAGA
TACGATAAAGAACCCTATGAAGAAGTGGGTGAGCTCAGTCATCGTATAAGTGAGGGAGGT
CTCTGGCTAGATGATTATTATCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAA
AGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCAATGAACGATTTCGAGGGCGT
CAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG60
120
180
240
300
360
420
480
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN034183_00140 [new locus tag: SPN034183_RS00070 ]
- symbol: ComX
- description: putative competence-specific global transcription modulator
- length: 159
- theoretical pI: 7.61287
- theoretical MW: 19845.3
- GRAVY: -1.09811
⊟Function[edit | edit source]
- TIGRFAM: RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 31.9)and 1 moreRNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 12.9)
- TheSEED :
- Competence-specific sigma factor ComX
- PFAM: HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 15.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by ComX1, sigma factor, controls the expression of late competence genes: in D39, D39V
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9764
- Cytoplasmic Membrane Score: 0.0169
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.0059
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003313
- TAT(Tat/SPI): 0.000225
- LIPO(Sec/SPII): 0.000847
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CCP31724 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLADDIPRLRKYFKTKFRNRILDYIRKQESQKRRYDKEPYEEVGELSHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0014 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
M S Lee, D A Morrison
Identification of a new regulator in Streptococcus pneumoniae linking quorum sensing to competence for genetic transformation.
J Bacteriol: 1999, 181(16);5004-16
[PubMed:10438773] [WorldCat.org] [DOI] (P p)