Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 26-AUG-2017
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPN994038
- locus tag: SPN994038_16770 [new locus tag: SPN994038_RS09160 ]
- pan locus tag?: PNEUPAN003506000
- symbol: SPN994038_16770
- pan gene symbol?: ytpP
- synonym:
- product: putative thioredoxin
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN994038_16770 [new locus tag: SPN994038_RS09160 ]
- symbol: SPN994038_16770
- product: putative thioredoxin
- replicon: chromosome
- strand: -
- coordinates: 1703866..1704183
- length: 318
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312041 (1703866..1704183) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1714 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATACAGCCAGCAAGTTTAGAAGAATTAGCATCTTTAGTGGAAAAAGCGGGCAAGAAG
GTCTTCCTTTTTGTGGCAGACTGGTGTGGCGATTGTCGTTATATTTATCCTGCCTTACCA
GAGATTGAGGAGACCAATCCAGAGTTCACCTTTATTCGAATGGACCGAGATCAGTATATG
GATTTGACCAAACTCTGGGATGTTTACGGAATTCCTAGCCTTGTTGTTCTAGAAAAGGAC
AAGGAAATCGGTCGTTTTGTCAATCGCGACCGTAAAAGCAAGCAACAAATCAATGACTTT
TTAGCAGGACTGAAATAG60
120
180
240
300
318
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN994038_16770 [new locus tag: SPN994038_RS09160 ]
- symbol: SPN994038_16770
- description: putative thioredoxin
- length: 105
- theoretical pI: 4.71898
- theoretical MW: 12249.1
- GRAVY: -0.294286
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 50.7)and 5 moreProtein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 31.4)protein disulfide isomerase (TIGR01130; HMM-score: 22.9)glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 14.5)glutaredoxin-like protein (TIGR02200; HMM-score: 12.9)Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 12.8)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 52)and 4 moreThioredoxin_9; Thioredoxin (PF14595; HMM-score: 38.1)Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 21.6)Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 17.9)Thioredoxin_7; Thioredoxin-like (PF13899; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9879
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0117
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.032188
- TAT(Tat/SPI): 0.00055
- LIPO(Sec/SPII): 0.012106
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CCP31413 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIQPASLEELASLVEKAGKKVFLFVADWCGDCRYIYPALPEIEETNPEFTFIRMDRDQYMDLTKLWDVYGIPSLVVLEKDKEIGRFVNRDRKSKQQINDFLAGLK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1714 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]