From PneumoWiki
Jump to navigation Jump to search
PangenomeTIGR4
serotype 4
D39
serotype 2
D39V
serotype 2
Hungary19A-6
serotype 19A
EF3030
serotype 19F
670-6B
serotype 6B
6A-10
serotype 6A
70585
serotype 5
A026
serotype 19F
A66
serotype 3
AP200
serotype 11A
ASP0581
serotype 12F
ATCC 49619
serotype 19F
ATCC 700669
serotype 23F
BM6001
serotype 19F
BVJ1JL
serotype 1
CGSP14
serotype 14
G54
serotype 19F
HU-OH
serotype 3
Hu15
serotype 19A
Hu17
serotype 19A
INV104
serotype 1
INV200
serotype 14
JJA
serotype 14
MDRSPN001
serotype 19F
NCTC7465
serotype 1
NCTC7466
serotype 2
NU83127
serotype 4
OXC141
serotype 3
P1031
serotype 1
R6
serotype 2
SP49
serotype 19A
SPN032672
serotype 1
SPN034156
serotype 3
SPN034183
serotype 3
SPN994038
serotype 3
SPN994039
serotype 3
SPNA45
serotype 3
ST556
serotype 19F
TCH8431/19A
serotype 19A
Taiwan19F-14
serotype 19F
Xen35
serotype 4
gamPNI0373
serotype 1

NCBI: 07-MAR-2025

Summary[edit | edit source]

  • organism: Streptococcus pneumoniae Hu15
  • locus tag: SPNHU15_RS08890 [old locus tag: SPNHU15_01882 ]
  • pan locus tag?: PNEUPAN003383000
  • symbol: SPNHU15_RS08890
  • pan gene symbol?: proV
  • synonym:
  • product: ATP-binding cassette domain-containing protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SPNHU15_RS08890 [old locus tag: SPNHU15_01882 ]
  • symbol: SPNHU15_RS08890
  • product: ATP-binding cassette domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1765079..1765807
  • length: 729
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NZ_CP020551 (1765079..1765807) NCBI
  • BioCyc:
  • MicrobesOnline:
  • PneumoBrowse for strain D39V: SPV_1643 PneumoBrowse

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGATTGAATACAAAAATGTAGCACTGCGCTACACAGAAAAGGATGTCTTGAGAGATGTC
    AACTTACAGATTGAGGATGGGGAATTTATGGTTTTAGTAGGGCCTTCTGGGTCAGGTAAG
    ACGACCATGCTCAAGATGATTAACCGTCTTTTGGAACCAACTGATGGAAATATTTATATG
    GATGGGAAGCGCATCAAAGACTATGATGAGCGTGAACTTCGTCTTTCTACTGGTTATGTT
    TTACAGGCTATTGCTCTTTTTCCAAATCTAACAGTTGCGGAAAATATTGCTCTCATTCCT
    GAAATGAAGGGGTGGAGCAAGGAAGAAATTACGAAGAAAACAGAAGAGCTTTTGGCTAAG
    GTTGGTTTACCAGTAGCCGAGTATGGGCATCGCTTACCTAGTGAATTATCTGGTGGAGAA
    CAGCAACGGGTCGGTATTGTCCGAGCTATGATTGGTCAGCCCAAGATTTTCCTCATGGAT
    GAACCCTTTTCGGCCTTGGATGCTATTTCGAGAAAACAGTTGCAGGTTCTGACAAAAGAA
    TTGCATAAAGAGTTTGGGATGACAACGATTTTTGTAACCCATGATACGGATGAAGCCTTG
    AAGTTGGCGGACCGTATTGCTGTCTTGCAGGATGGAGAAATTCGCCAGGTAGCGAATCCC
    GAGACAATTTTAAAAGCGCCTGCAACAGACTTTGTAGCAGACTTGTTTGGAGGTAGTGTT
    CATGACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    729

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SPNHU15_RS08890 [old locus tag: SPNHU15_01882 ]
  • symbol: SPNHU15_RS08890
  • description: ATP-binding cassette domain-containing protein
  • length: 242
  • theoretical pI: 4.84028
  • theoretical MW: 27061
  • GRAVY: -0.195455

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 286.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 244.7)
    and 84 more
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 225.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 216.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 198.5)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 188.6)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 182.3)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 180.8)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 174.5)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 170.3)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 167.7)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 161)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 158.6)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 157.9)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 156.3)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 156.3)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 154.9)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 153.2)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 153.2)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 151)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 151)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 148.3)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 147.2)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 145.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 145.9)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 145.4)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 143.1)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 143.1)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 141.8)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 133.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 132.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 132.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 131.4)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 131.2)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 127.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 127.1)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 126.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 126.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 124.2)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 121.5)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 120.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 120.8)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 115.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 109.9)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 105.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 105.1)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 105.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 104.6)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 104.6)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 104.6)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 103.9)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 102.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 100.8)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 98.6)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 95.9)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 95.3)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 94)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 93.7)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 89.7)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 89.7)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 86.3)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 83.2)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 82.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 74)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 69.8)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 69.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 64.8)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 64.8)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 54.3)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 43.2)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 35)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 22.3)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 16.7)
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 15.9)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 15.1)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 14.2)
    Unknown function General Mg chelatase-like protein (TIGR00368; HMM-score: 14.1)
    Metabolism Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 14)
    Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AA (TIGR02858; HMM-score: 13.3)
    P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 13.1)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions guanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 13.1)
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent Clp protease, ATP-binding subunit ClpX (TIGR00382; HMM-score: 11.8)
    Genetic information processing Protein fate Protein folding and stabilization ATP-dependent Clp protease, ATP-binding subunit ClpX (TIGR00382; HMM-score: 11.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EccCb (TIGR03925; HMM-score: 11.8)
    carbohydrate kinase, thermoresistant glucokinase family (TIGR01313; EC 2.7.1.-; HMM-score: 11.6)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 11.3)
  • TheSEED: data available for D39, Hungary19A-6, TIGR4
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 122.5)
    and 43 more
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 23.3)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 23.1)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 21.8)
    AAA_30; AAA domain (PF13604; HMM-score: 21.7)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 21.6)
    AAA_22; AAA domain (PF13401; HMM-score: 21.2)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 21.2)
    NTPase_1; NTPase (PF03266; HMM-score: 21.1)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 20.3)
    ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 18.3)
    AAA_14; AAA domain (PF13173; HMM-score: 17.7)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17.4)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 16.7)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 16.3)
    Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 16.2)
    AAA_23; AAA domain (PF13476; HMM-score: 16.2)
    ATPase; KaiC (PF06745; HMM-score: 16.1)
    Zeta_toxin; Zeta toxin (PF06414; HMM-score: 15.5)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.4)
    G-alpha; G-protein alpha subunit (PF00503; HMM-score: 15)
    AAA_18; AAA domain (PF13238; HMM-score: 15)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 14.8)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 14.8)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 14.7)
    AAA_19; AAA domain (PF13245; HMM-score: 14.6)
    NACHT; NACHT domain (PF05729; HMM-score: 14.3)
    AAA_24; AAA domain (PF13479; HMM-score: 14.2)
    AAA_33; AAA domain (PF13671; HMM-score: 14)
    bpMoxR; MoxR domain in the MoxR-vWA-beta-propeller ternary systems (PF20030; HMM-score: 14)
    Rad17; Rad17 P-loop domain (PF03215; HMM-score: 13.9)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 13.7)
    Pox_A32; Poxvirus A32 protein (PF04665; HMM-score: 13)
    AAA_7; P-loop containing dynein motor region (PF12775; HMM-score: 12.6)
    APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 12.2)
    ResIII; Type III restriction enzyme, res subunit (PF04851; HMM-score: 12.2)
    AAA_25; AAA domain (PF13481; HMM-score: 12.2)
    SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 12.2)
    T4SS-DNA_transf; Type IV secretory system Conjugative DNA transfer (PF02534; HMM-score: 12)
    RNA12; RNA12 protein (PF10443; HMM-score: 12)
    PEP-carboxyk (CL0374) PEPCK_ATP; Phosphoenolpyruvate carboxykinase (PF01293; HMM-score: 11.6)
    no clan defined DUF3987; Protein of unknown function (DUF3987) (PF13148; HMM-score: 11)
    P-loop_NTPase (CL0023) AAA_PrkA; PrkA AAA domain (PF08298; HMM-score: 10.9)
    Spore_III_AA; Sporulation stage III, protein AA (PF19568; HMM-score: 10.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0857
    • Cytoplasmic Membrane Score: 0.9049
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0093
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002096
    • TAT(Tat/SPI): 0.000162
    • LIPO(Sec/SPII): 0.000447
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000575209 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIEYKNVALRYTEKDVLRDVNLQIEDGEFMVLVGPSGSGKTTMLKMINRLLEPTDGNIYMDGKRIKDYDERELRLSTGYVLQAIALFPNLTVAENIALIPEMKGWSKEEITKKTEELLAKVGLPVAEYGHRLPSELSGGEQQRVGIVRAMIGQPKIFLMDEPFSALDAISRKQLQVLTKELHKEFGMTTIFVTHDTDEALKLADRIAVLQDGEIRQVANPETILKAPATDFVADLFGGSVHD

Experimental data[edit | edit source]

  • protein localization:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription[edit | edit source]

  • transcription start site:

Expression data[edit | edit source]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]