Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 23-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_RS09235 [old locus tag: SP_1861 ]
- pan locus tag?: PNEUPAN003383000
- symbol: SP_RS09235
- pan gene symbol?: proV
- synonym:
- product: ATP-binding cassette domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_RS09235 [old locus tag: SP_1861 ]
- symbol: SP_RS09235
- product: ATP-binding cassette domain-containing protein
- replicon: chromosome
- strand: -
- coordinates: 1768969..1769697
- length: 729
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_003028 (1768969..1769697) NCBI
- BioCyc:
- MicrobesOnline: see SP_1861
- PneumoBrowse for strain D39V: SPV_1643 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGATTGAATACAAAAATGTAGCACTGCGCTACACAGAAAAGGATGTCTTGAGAGATGTC
AACTTACAGATTGAGGATGGGGAATTTATGGTTTTAGTAGGGCCTTCTGGGTCAGGTAAG
ACGACCATGCTCAAGATGATTAACCGTCTTTTGGAACCAACTGATGGAAATATTTATATG
GATGGGAAGCGCATCAAAGACTATGATGAGCGTGAACTTCGTCTTTCTACTGGTTATGTT
TTACAGGCTATTGCTCTTTTTCCAAATCTAACAGTTGCGGAAAATATTGCTCTCATTCCT
GAAATGAAGGGGTGGAGCAAGGAAGAAATTACGAAGAAAACAGAAGAGCTTTTGGCTAAG
GTTGGTTTACCAGTAGCCGAGTATGGGCATCGCTTACCTAGTGAATTATCTGGTGGAGAA
CAGCAACGGGTCGGTATTGTCCGAGCTATGATTGGTCAGCCCAAGATTTTCCTCATGGAT
GAACCCTTTTCGGCCTTGGATGCTATTTCGAGAAAACAGTTGCAGGTTCTGACAAAAGAA
TTGCATAAAGAGTTTGGGATGACAACGATTTTTGTAACCCATGATACGGATGAAGCCTTG
AAGTTGGCGGACCGTATTGCTGTCTTGCAGGATGGAGAAATTCGCCAGGTAGCGAATCCC
GAGACAATTTTAAAAGCGCCTGCAACAGACTTTGTAGCAGACTTGTTTGGAGGTAGTGTT
CATGACTAA60
120
180
240
300
360
420
480
540
600
660
720
729
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_RS09235 [old locus tag: SP_1861 ]
- symbol: SP_RS09235
- description: ATP-binding cassette domain-containing protein
- length: 242
- theoretical pI: 4.84028
- theoretical MW: 27061
- GRAVY: -0.195455
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 286.5)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 244.7)and 84 moreTransport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 225.2)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 216.9)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 198.5)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 188.6)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 182.3)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 180.8)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 174.5)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 170.3)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 167.7)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 161)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 158.6)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 157.9)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 156.3)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 156.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 154.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 153.2)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 153.2)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 151)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 151)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 148.3)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 147.2)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 145.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 145.9)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 145.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 143.1)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 143.1)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 141.8)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 133.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 132.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 132.4)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 131.4)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 131.2)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 127.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 127.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 126.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 126.3)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 124.2)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 121.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 120.8)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 120.8)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 115.4)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 109.9)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 105.7)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 105.1)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 105.1)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 104.6)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 104.6)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 104.6)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 103.9)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 102.2)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 100.8)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 98.6)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 95.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 95.3)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 94)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 93.7)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 89.7)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 89.7)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 86.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 83.2)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 82.8)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 74)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 69.8)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 69.8)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 64.8)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 64.8)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 54.3)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 43.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 35)DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 22.3)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 16.7)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 15.9)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 15.1)DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 14.2)Unknown function General Mg chelatase-like protein (TIGR00368; HMM-score: 14.1)Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 14)Cellular processes Sporulation and germination stage III sporulation protein AA (TIGR02858; HMM-score: 13.3)P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 13.1)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions guanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 13.1)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent Clp protease, ATP-binding subunit ClpX (TIGR00382; HMM-score: 11.8)Protein fate Protein folding and stabilization ATP-dependent Clp protease, ATP-binding subunit ClpX (TIGR00382; HMM-score: 11.8)Protein fate Protein and peptide secretion and trafficking type VII secretion protein EccCb (TIGR03925; HMM-score: 11.8)carbohydrate kinase, thermoresistant glucokinase family (TIGR01313; EC 2.7.1.-; HMM-score: 11.6)Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 11.3)
- TheSEED: see SP_1861
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 122.5)and 43 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 23.3)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 23.1)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 21.8)AAA_30; AAA domain (PF13604; HMM-score: 21.7)AAA_16; AAA ATPase domain (PF13191; HMM-score: 21.6)AAA_22; AAA domain (PF13401; HMM-score: 21.2)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 21.2)NTPase_1; NTPase (PF03266; HMM-score: 21.1)AAA_15; AAA ATPase domain (PF13175; HMM-score: 20.3)ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 18.3)AAA_14; AAA domain (PF13173; HMM-score: 17.7)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17.4)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 16.7)T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 16.3)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 16.2)AAA_23; AAA domain (PF13476; HMM-score: 16.2)ATPase; KaiC (PF06745; HMM-score: 16.1)Zeta_toxin; Zeta toxin (PF06414; HMM-score: 15.5)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.4)G-alpha; G-protein alpha subunit (PF00503; HMM-score: 15)AAA_18; AAA domain (PF13238; HMM-score: 15)NB-ARC; NB-ARC domain (PF00931; HMM-score: 14.8)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 14.8)RNA_helicase; RNA helicase (PF00910; HMM-score: 14.7)AAA_19; AAA domain (PF13245; HMM-score: 14.6)NACHT; NACHT domain (PF05729; HMM-score: 14.3)AAA_24; AAA domain (PF13479; HMM-score: 14.2)AAA_33; AAA domain (PF13671; HMM-score: 14)bpMoxR; MoxR domain in the MoxR-vWA-beta-propeller ternary systems (PF20030; HMM-score: 14)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 13.9)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 13.7)Pox_A32; Poxvirus A32 protein (PF04665; HMM-score: 13)AAA_7; P-loop containing dynein motor region (PF12775; HMM-score: 12.6)APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 12.2)ResIII; Type III restriction enzyme, res subunit (PF04851; HMM-score: 12.2)AAA_25; AAA domain (PF13481; HMM-score: 12.2)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 12.2)T4SS-DNA_transf; Type IV secretory system Conjugative DNA transfer (PF02534; HMM-score: 12)RNA12; RNA12 protein (PF10443; HMM-score: 12)PEP-carboxyk (CL0374) PEPCK_ATP; Phosphoenolpyruvate carboxykinase (PF01293; HMM-score: 11.6)no clan defined DUF3987; Protein of unknown function (DUF3987) (PF13148; HMM-score: 11)P-loop_NTPase (CL0023) AAA_PrkA; PrkA AAA domain (PF08298; HMM-score: 10.9)Spore_III_AA; Sporulation stage III, protein AA (PF19568; HMM-score: 10.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 9.99
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0857
- Cytoplasmic Membrane Score: 0.9049
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0093
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002096
- TAT(Tat/SPI): 0.000162
- LIPO(Sec/SPII): 0.000447
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIEYKNVALRYTEKDVLRDVNLQIEDGEFMVLVGPSGSGKTTMLKMINRLLEPTDGNIYMDGKRIKDYDERELRLSTGYVLQAIALFPNLTVAENIALIPEMKGWSKEEITKKTEELLAKVGLPVAEYGHRLPSELSGGEQQRVGIVRAMIGQPKIFLMDEPFSALDAISRKQLQVLTKELHKEFGMTTIFVTHDTDEALKLADRIAVLQDGEIRQVANPETILKAPATDFVADLFGGSVHD
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1643 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]