Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae P1031
- locus tag: SPP_2186 [new locus tag: SPP_RS10790 ]
- pan locus tag?: PNEUPAN003815000
- symbol: SPP_2186
- pan gene symbol?: ulaB2
- synonym:
- product: phosphotransferase system, galactitol-specific IIB component
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPP_2186 [new locus tag: SPP_RS10790 ]
- symbol: SPP_2186
- product: phosphotransferase system, galactitol-specific IIB component
- replicon: chromosome
- strand: -
- coordinates: 1998843..1999127
- length: 285
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000920 (1998843..1999127) NCBI
- BioCyc: see SPP_RS10790
- MicrobesOnline: 7482663 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1960 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTAAAAATTGGTACAGCTTGTGGTTCAGGATTAGGTTCAAGTTTTATGGTACAGATG
AATATTGAATCTGTATTGAGTGATTTGAATGTTTCGGATGTAGAAGTTGAACATTATGAT
TTAGGTGGAGCAGATCCAAATGCAGCTGATATTTGGATTGTTGGTCGTGATCTAGCTGAT
TCAGCTAGTCATCTTGGAGATGTTCGTATCTTAAATAGTATTATTGATATGGATGAACTA
CGAGAATTAATTACTAAACTTTGTGAAGAAAAAGGACTTATATAG60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPP_2186 [new locus tag: SPP_RS10790 ]
- symbol: SPP_2186
- description: phosphotransferase system, galactitol-specific IIB component
- length: 94
- theoretical pI: 3.96118
- theoretical MW: 10105.4
- GRAVY: 0.181915
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9958
- Cytoplasmic Membrane Score: 0.0016
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0025
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.210169
- TAT(Tat/SPI): 0.002991
- LIPO(Sec/SPII): 0.005619
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACO20736 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLKIGTACGSGLGSSFMVQMNIESVLSDLNVSDVEVEHYDLGGADPNAADIWIVGRDLADSASHLGDVRILNSIIDMDELRELITKLCEEKGLI
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1960 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.