Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_0652 [new locus tag: SP_RS03205 ]
- pan locus tag?: PNEUPAN001559000
- symbol: SP_0652
- pan gene symbol?: ytqB
- synonym:
- product: conserved hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_0652 [new locus tag: SP_RS03205 ]
- symbol: SP_0652
- product: conserved hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 624848..625405
- length: 558
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AE005672 (624848..625405) NCBI
- BioCyc:
- MicrobesOnline: 116156 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_0567 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAAAAGACCACTTGAGATGGCACATGATTTTTTGGCTGAGGTCGTGACAAAAGAGGAT
GTCGTAGTGGATGCGACTATGGGAAATGGTCATGACACGCTTTTTTTAGCCAAGCTAGCC
AAGCAAGTCTATGCCTTTGATATTCAGAAGCAAGCCTTGGAAAAGACCCAAGAGCGTTTG
CATCAGGCTGACTTGACAAATGCCCAGTTAATCTTGCAAGGCCATGAGACACTGGACCAG
TTTGTGATAAAAGCTAAGGCAGGGATTTTTAATCTGGGCTATTTGCCGGCAGCTGATAAG
TCTGTCATCACCCGACCGCAGACAACGATTGAGGCATTAGAAAAGCTATGTGGCTTACTT
GTCAAAGGTGGACGAATTGCTATTATGATTTACTATGGTCATGAAGGAGGCGATCTCGAG
AGAGATGCTGTCTTGGATTTTGTGATCCAGTTGAACCAACAAGAGTACACAGCTGCCATT
TACCGAACTTTAAACCAAGTCAACAACCCGCCGTTTTTAGTGATGATTGAAAAATTAGAG
AGATACAGACATGGATAA60
120
180
240
300
360
420
480
540
558
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_0652 [new locus tag: SP_RS03205 ]
- symbol: SP_0652
- description: conserved hypothetical protein
- length: 185
- theoretical pI: 6.24192
- theoretical MW: 20866.9
- GRAVY: -0.142703
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 29.8)and 9 moreBiosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 19.5)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 16.2)Protein synthesis tRNA and rRNA base modification tRNA (uracil(54)-C(5))-methyltransferase (TIGR02143; EC 2.1.1.35; HMM-score: 16.1)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 15.8)Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 13.7)Amino acid biosynthesis Other pyrrolysine biosynthesis protein PylD (TIGR03911; HMM-score: 13.1)Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 12.3)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 12.2)Unknown function General TlyA family rRNA methyltransferase/putative hemolysin (TIGR00478; HMM-score: 11.5)
- TheSEED :
- SAM-dependent methyltransferase, MraW methylase family (EC 2.1.1.-)
- PFAM: NADP_Rossmann (CL0063) rRNA_methylase; Putative rRNA methylase (PF06962; HMM-score: 163.8)and 19 moreMethyltransf_31; Methyltransferase domain (PF13847; HMM-score: 31.4)Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 29.8)Methyltransf_5; MraW methylase family (PF01795; HMM-score: 22.7)Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 18)Met_10; Met-10+ like-protein (PF02475; HMM-score: 17.2)Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 17.2)Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 17.2)MTS; Methyltransferase small domain (PF05175; HMM-score: 17)Methyltransf_32; Methyltransferase domain (PF13679; HMM-score: 16.8)tRNA_U5-meth_tr; tRNA (Uracil-5-)-methyltransferase (PF05958; HMM-score: 15.9)N6_N4_Mtase; DNA methylase (PF01555; HMM-score: 14.8)RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 14.3)Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 14.2)Methyltransf_33; Histidine-specific methyltransferase, SAM-dependent (PF10017; HMM-score: 13.7)no clan defined DUF4866; Domain of unknown function (DUF4866) (PF16160; HMM-score: 13.6)NADP_Rossmann (CL0063) TehB; Tellurite resistance protein TehB (PF03848; HMM-score: 13)Methyltrans_SAM; S-adenosylmethionine-dependent methyltransferase (PF10672; HMM-score: 13)PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 12.9)no clan defined DUF4191; Domain of unknown function (DUF4191) (PF13829; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.997
- Cytoplasmic Membrane Score: 0.001
- Cell wall & surface Score: 0.0011
- Extracellular Score: 0.001
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003189
- TAT(Tat/SPI): 0.000443
- LIPO(Sec/SPII): 0.000346
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKRPLEMAHDFLAEVVTKEDVVVDATMGNGHDTLFLAKLAKQVYAFDIQKQALEKTQERLHQADLTNAQLILQGHETLDQFVIKAKAGIFNLGYLPAADKSVITRPQTTIEALEKLCGLLVKGGRIAIMIYYGHEGGDLERDAVLDFVIQLNQQEYTAAIYRTLNQVNNPPFLVMIEKLERYRHG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0567 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)