Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae A026
- locus tag: T308_07820 [new locus tag: T308_RS07985 ]
- pan locus tag?: PNEUPAN003136000
- symbol: T308_07820
- pan gene symbol?: nrdR
- synonym:
- product: NrdR family transcriptional regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: T308_07820 [new locus tag: T308_RS07985 ]
- symbol: T308_07820
- product: NrdR family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 1535895..1536428
- length: 534
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP006844 (1535895..1536428) NCBI
- BioCyc: see T308_RS07985
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1523 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481TTGTTTTGGGAATCGCTTAAAAAATGGTATAATGAAAAGAAAACGATAAGGAGGGAAAGG
ATGCGTTGTCCAAAATGTGGGGCTACCAAGTCAAGTGTTATCGATAGTCGCCAAGCAGAA
GAAGGGAACACCATTCGTAGAAGACGAGAGTGCGACGAGTGCCAACACCGTTTTACAACC
TACGAACGAGTAGAAGAAAGAACCTTAGTGGTTGTTAAAAAAGATGGCACACGGGAACAA
TTCTCCAGAGATAAAATCTTTAATGGGATTATCCGCTCAGCCCAGAAACGTCCTGTGTCA
AGTGATGAAATCAACATGGTAGTCAATCGTATCGAACAGAAACTCCGTGGTCGAAATGAA
AATGAAATTCAAAGTGAGGACATTGGTTCACTCGTCATGGAGGAGTTGGCTGAATTGGAC
GAGATTACCTATGTACGTTTTGCTAGTGTCTATCGTAGTTTTAAGGATGTCAGTGAGTTA
GAGAGCTTGCTCCAACAAATCACCCAGTCCTCTAAAAAGAAAAAGGAAAGATAA60
120
180
240
300
360
420
480
534
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: T308_07820 [new locus tag: T308_RS07985 ]
- symbol: T308_07820
- description: NrdR family transcriptional regulator
- length: 177
- theoretical pI: 9.69227
- theoretical MW: 21090.8
- GRAVY: -1.01017
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator NrdR (TIGR00244; HMM-score: 189.7)and 7 moreRegulatory functions DNA interactions putative regulatory protein, FmdB family (TIGR02605; HMM-score: 16.1)Mobile and extrachromosomal element functions Prophage functions restriction alleviation protein, Lar family (TIGR03655; HMM-score: 16.1)DNA metabolism Restriction/modification restriction alleviation protein, Lar family (TIGR03655; HMM-score: 16.1)Cys-rich peptide, TIGR04165 family (TIGR04165; HMM-score: 13.9)Transcription Transcription factors transcription factor S (TIGR01384; HMM-score: 13.6)cxxc_20_cxxc protein (TIGR04104; HMM-score: 11)MJ0042 family finger-like domain (TIGR02098; HMM-score: 8.5)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: no clan defined ATP-cone; ATP cone domain (PF03477; HMM-score: 73.2)and 13 moreZn_Beta_Ribbon (CL0167) Zn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 20.7)TFIIS_C; Transcription factor S-II (TFIIS) (PF01096; HMM-score: 20.6)Ribosomal_S27; Ribosomal protein S27a (PF01599; HMM-score: 16)Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 15.4)no clan defined DnaJ_CXXCXGXG; DnaJ central domain (PF00684; HMM-score: 14.8)DiS_P_DiS; Bacterial Peptidase A24 N-terminal domain (PF06750; HMM-score: 14)POTRA (CL0191) POTRA_2; POTRA domain, ShlB-type (PF08479; HMM-score: 13.4)Zn_Beta_Ribbon (CL0167) zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 12.7)Beta-tent (CL0080) GFA; Glutathione-dependent formaldehyde-activating enzyme (PF04828; HMM-score: 12.5)no clan defined FdhE; Protein involved in formate dehydrogenase formation (PF04216; HMM-score: 11.6)HypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 11.1)Zn_Beta_Ribbon (CL0167) zinc_ribbon_4; zinc-ribbon domain (PF13717; HMM-score: 10)Nudix_N_2; Nudix N-terminal (PF14803; HMM-score: 9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9264
- Cytoplasmic Membrane Score: 0.0158
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0572
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.018785
- TAT(Tat/SPI): 0.00453
- LIPO(Sec/SPII): 0.010029
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: AGZ48247 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFWESLKKWYNEKKTIRRERMRCPKCGATKSSVIDSRQAEEGNTIRRRRECDECQHRFTTYERVEERTLVVVKKDGTREQFSRDKIFNGIIRSAQKRPVSSDEINMVVNRIEQKLRGRNENEIQSEDIGSLVMEELAELDEITYVRFASVYRSFKDVSELESLLQQITQSSKKKKER
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1523 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]