Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 17-JAN-2018
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae AP200
- locus tag: SPAP_1068 [new locus tag: SPAP_RS13180 ]
- pan locus tag?: PNEUPAN002264000
- symbol: SPAP_1068
- pan gene symbol?: —
- synonym:
- product: Phosphoserine phosphatase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPAP_1068 [new locus tag: SPAP_RS13180 ]
- symbol: SPAP_1068
- product: Phosphoserine phosphatase
- replicon: chromosome
- strand: -
- coordinates: 1018243..1018572
- length: 330
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP002121 (1018243..1018572) NCBI
- BioCyc: see SPAP_RS13180
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301TTGGAGAGATTAGCAAAATCCCTTGGTATTGCCTATTTCACTGCCAACCAGCTTGAAGTC
AAAGAAGGTCTTTTAACAGGAAAATTAGTTGGACAAATTATAAGTCCCCAGGTCAAAAAA
GAAACTCTGGAAAAATGGAGAAAGAAACTAAAACTTTCTAAAGAAAGAACGGTGGCAATC
GGTGATGGGGTCAATAATCTATTAATGTTGAAGTCGGCGGAGTTAGGAATCGCCTTTTGT
GCCAAAGAAGTGCTCAAAAAAGAAATACCACATCATGTTGACAAGAGGGATTTTTTAGAA
GTTCTTCCTTTGATTGACTGTTTAGAATGA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPAP_1068 [new locus tag: SPAP_RS13180 ]
- symbol: SPAP_1068
- description: Phosphoserine phosphatase
- length: 109
- theoretical pI: 9.63549
- theoretical MW: 12269.5
- GRAVY: -0.0816514
⊟Function[edit | edit source]
- TIGRFAM: Amino acid biosynthesis Serine family phosphoserine phosphatase SerB (TIGR00338; EC 3.1.3.3; HMM-score: 97.2)and 18 moreUnknown function Enzymes of unknown specificity Cof-like hydrolase (TIGR00099; HMM-score: 35.2)Unknown function Enzymes of unknown specificity HAD phosphoserine phosphatase-like hydrolase, family IB (TIGR01488; HMM-score: 34.1)phosphoserine phosphatase-like hydrolase, archaeal (TIGR01491; HMM-score: 33.9)HAD ATPase, P-type, family IC (TIGR01494; EC 3.6.3.-; HMM-score: 30.5)Unknown function Enzymes of unknown specificity HAD hydrolase, family IB (TIGR01490; HMM-score: 28.4)phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein (TIGR02137; EC 3.1.3.3; HMM-score: 21)heavy metal translocating P-type ATPase (TIGR01525; EC 3.6.3.-; HMM-score: 19.2)phosphoglycolate phosphatase, TA0175-type (TIGR01487; EC 3.1.3.18; HMM-score: 18.3)Transport and binding proteins Cations and iron carrying compounds cadmium-translocating P-type ATPase (TIGR01512; EC 3.6.3.3; HMM-score: 16.1)Cellular processes Detoxification copper-translocating P-type ATPase (TIGR01511; EC 3.6.3.4; HMM-score: 14.3)Transport and binding proteins Cations and iron carrying compounds copper-translocating P-type ATPase (TIGR01511; EC 3.6.3.4; HMM-score: 14.3)phospholipid-translocating P-type ATPase, flippase (TIGR01652; EC 3.6.3.1; HMM-score: 14)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family (TIGR01670; EC 3.1.3.45; HMM-score: 14)sucrose-phosphate phosphatase subfamily (TIGR01482; EC 3.1.3.-; HMM-score: 13.3)P-type ATPase of unknown pump specificity (type V) (TIGR01657; HMM-score: 13.1)Unknown function Enzymes of unknown specificity HAD hydrolase, family IIB (TIGR01484; HMM-score: 12.3)Transport and binding proteins Cations and iron carrying compounds calcium-translocating P-type ATPase, SERCA-type (TIGR01116; EC 3.6.3.8; HMM-score: 10.5)potassium/sodium efflux P-type ATPase, fungal-type (TIGR01523; EC 3.6.3.-; HMM-score: 10.3)
- TheSEED :
- Phosphoserine phosphatase (EC 3.1.3.3)
Amino Acids and Derivatives Alanine, serine, and glycine Glycine and Serine Utilization Phosphoserine phosphatase (EC 3.1.3.3)and 1 more - PFAM: HAD (CL0137) Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 30.7)Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 28.5)and 2 moreHAD; haloacid dehalogenase-like hydrolase (PF12710; HMM-score: 23.6)S6PP; Sucrose-6F-phosphate phosphohydrolase (PF05116; HMM-score: 14.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9956
- Cytoplasmic Membrane Score: 0.0016
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0026
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010923
- TAT(Tat/SPI): 0.000709
- LIPO(Sec/SPII): 0.001669
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ADM84657 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MERLAKSLGIAYFTANQLEVKEGLLTGKLVGQIISPQVKKETLEKWRKKLKLSKERTVAIGDGVNNLLMLKSAELGIAFCAKEVLKKEIPHHVDKRDFLEVLPLIDCLE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]