Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 25-OCT-2019
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ATCC 49619
- locus tag: SPAT_1617 [new locus tag: EL263_RS08490 ]
- pan locus tag?: PNEUPAN003180000
- symbol: gph_2
- pan gene symbol?: yqeG
- synonym:
- product: Phosphoglycolate phosphatase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPAT_1617 [new locus tag: EL263_RS08490 ]
- symbol: gph_2
- product: Phosphoglycolate phosphatase
- replicon: chromosome
- strand: -
- coordinates: 1609093..1609620
- length: 528
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: AP018938 (1609093..1609620) NCBI
- BioCyc: see EL263_RS08490
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1560 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGGCGATTGAAAATTATATACCAGATTTTGCTGTGGAAGCAGTCTATGATCTGACAGTC
CCAAGCCTGCAGGCGCAGGGAATCAAGGCTGTTTTGGTCGATTTGGATAATACCCTCATT
GCTTGGAACAACCCTGATGGAACGCCAGAGATGAAGCAATGGCTACATGACCTTCGGGAC
GCGGGTATTGGCATTATCGTAGTGTCAAATAACACCAAAAAACGCGTTCAACGAGCAGTT
GAGAAATTTGGGATTGATTACGTTTACTGGGCCTTGAAGCCCTTCACATTTGGTATTGAC
CGTGCTATGAAGGAATTCCACTATGACAAAAAGGAAGTGGTCATGGTTGGTGACCAGCTC
ATGACAGATATACGAGCAGCCCACCGTGCAGGGATTCGGTCAATTTTAGTCAAACCCTTG
GTCCAACATGACTCAATCAAAACGCAGATTAACCGAACTCGTGAGCGTCGTGTTATGAGA
AAAATCACTGAAAAGTACGGACCGATTACATATAAAAAAGGAATTTAA60
120
180
240
300
360
420
480
528
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPAT_1617 [new locus tag: EL263_RS08490 ]
- symbol: Gph_2
- description: Phosphoglycolate phosphatase
- length: 175
- theoretical pI: 9.98169
- theoretical MW: 20100.2
- GRAVY: -0.289714
⊟Function[edit | edit source]
- TIGRFAM: HAD phosphatase, family IIIA (TIGR01668; EC 3.1.3.-; HMM-score: 135.5)and 34 moreUnknown function Enzymes of unknown specificity HAD hydrolase, family IIIA (TIGR01662; HMM-score: 70.9)Unknown function Enzymes of unknown specificity HAD hydrolase, family IIA (TIGR01460; HMM-score: 49.3)HAD hydrolase, TIGR02253 family (TIGR02253; HMM-score: 45.1)Unknown function Enzymes of unknown specificity HAD hydrolase, TIGR01457 family (TIGR01457; HMM-score: 44.2)phosphoglycolate/pyridoxal phosphate phosphatase family (TIGR01452; EC 3.1.3.18; HMM-score: 32.7)HAD hydrolase, REG-2-like, family IA (TIGR02252; HMM-score: 30.8)Unknown function Enzymes of unknown specificity HAD hydrolase, TIGR01458 family (TIGR01458; HMM-score: 29.7)Unknown function Enzymes of unknown specificity HAD hydrolase, family IA, variant 3 (TIGR01509; HMM-score: 29.3)noncanonical pyrimidine nucleotidase, YjjG family (TIGR02254; EC 3.1.3.5; HMM-score: 27.9)HAD hydrolase, TIGR01459 family (TIGR01459; HMM-score: 27.8)Unknown function Enzymes of unknown specificity HAD hydrolase, family IIB (TIGR01484; HMM-score: 27.1)histidinol-phosphate phosphatase domain (TIGR01656; HMM-score: 27.1)HAD phosphatase, family IIIC (TIGR01681; HMM-score: 27)haloacid dehalogenase, type II (TIGR01428; EC 3.8.1.2; HMM-score: 25.1)Unknown function Enzymes of unknown specificity HAD hydrolase, family IA, variant 1 (TIGR01549; HMM-score: 25.1)mannosyl-3-phosphoglycerate phosphatase family (TIGR01486; EC 3.1.3.-; HMM-score: 23.4)Unknown function Enzymes of unknown specificity Cof-like hydrolase (TIGR00099; HMM-score: 23.1)AHBA synthesis associated protein (TIGR01454; HMM-score: 18.3)phosphoglycolate phosphatase, TA0175-type (TIGR01487; EC 3.1.3.18; HMM-score: 18.1)pyrimidine 5'-nucleotidase (TIGR01993; EC 3.1.3.5; HMM-score: 18)Energy metabolism Sugars phosphoglycolate phosphatase, bacterial (TIGR01449; EC 3.1.3.18; HMM-score: 17.8)Unknown function Enzymes of unknown specificity HAD phosphoserine phosphatase-like hydrolase, family IB (TIGR01488; HMM-score: 17.6)mannosyl-3-phosphoglycerate phosphatase (TIGR02461; EC 3.1.3.70; HMM-score: 16.5)viral phosphatase (TIGR01684; HMM-score: 16.3)Unknown function General mannosyl-3-phosphoglycerate phosphatase homolog (TIGR02463; EC 3.1.3.-; HMM-score: 15.2)HAD hydrolase, TIGR01456 family (TIGR01456; HMM-score: 14.7)heavy metal translocating P-type ATPase (TIGR01525; EC 3.6.3.-; HMM-score: 14.7)Cellular processes Detoxification copper-translocating P-type ATPase (TIGR01511; EC 3.6.3.4; HMM-score: 14)Transport and binding proteins Cations and iron carrying compounds copper-translocating P-type ATPase (TIGR01511; EC 3.6.3.4; HMM-score: 14)HAD hydrolase, TIGR01548 family (TIGR01548; HMM-score: 13.8)Amino acid biosynthesis Serine family phosphoserine phosphatase SerB (TIGR00338; EC 3.1.3.3; HMM-score: 13.5)Amino acid biosynthesis Histidine family histidinol-phosphatase (TIGR01261; EC 3.1.3.15; HMM-score: 12)FkbH domain (TIGR01686; HMM-score: 12)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides D,D-heptose 1,7-bisphosphate phosphatase (TIGR00213; HMM-score: 11.9)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: HAD (CL0137) HAD_2; haloacid dehalogenase-like hydrolase (PF13419; HMM-score: 60.2)Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 51.2)Hydrolase_like; HAD-hyrolase-like (PF13242; HMM-score: 50.9)and 11 morePGP_phosphatase; Mitochondrial PGP phosphatase (PF09419; HMM-score: 43.7)Hydrolase_6; haloacid dehalogenase-like hydrolase (PF13344; HMM-score: 21.5)Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 19.6)TPR (CL0020) VPS53_C; Vacuolar protein sorting-associated protein 53 C-terminus (PF16854; HMM-score: 18.8)HAD (CL0137) HAD; haloacid dehalogenase-like hydrolase (PF12710; HMM-score: 18)no clan defined DUF6555; Family of unknown function (DUF6555) (PF20192; HMM-score: 17.8)HAD (CL0137) DUF705; Protein of unknown function (DUF705) (PF05152; HMM-score: 16.3)Acid_phosphat_B; HAD superfamily, subfamily IIIB (Acid phosphatase) (PF03767; HMM-score: 14.4)Thioredoxin (CL0172) AhpC-TSA; AhpC/TSA family (PF00578; HMM-score: 13.6)HAD (CL0137) S6PP; Sucrose-6F-phosphate phosphohydrolase (PF05116; HMM-score: 12.5)PLP_aminotran (CL0061) SepSecS; O-phosphoseryl-tRNA(Sec) selenium transferase, SepSecS (PF05889; HMM-score: 11.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.2367
- Cytoplasmic Membrane Score: 0.7578
- Cell wall & surface Score: 0
- Extracellular Score: 0.0054
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005889
- TAT(Tat/SPI): 0.000221
- LIPO(Sec/SPII): 0.000531
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: BBG39665 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MAIENYIPDFAVEAVYDLTVPSLQAQGIKAVLVDLDNTLIAWNNPDGTPEMKQWLHDLRDAGIGIIVVSNNTKKRVQRAVEKFGIDYVYWALKPFTFGIDRAMKEFHYDKKEVVMVGDQLMTDIRAAHRAGIRSILVKPLVQHDSIKTQINRTRERRVMRKITEKYGPITYKKGI
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1560 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]