Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hungary19A-6
- locus tag: SPH_1866 [new locus tag: SPH_RS09095 ]
- pan locus tag?: PNEUPAN003185000
- symbol: SPH_1866
- pan gene symbol?: asp5
- synonym:
- product: conserved hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPH_1866 [new locus tag: SPH_RS09095 ]
- symbol: SPH_1866
- product: conserved hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1723528..1723752
- length: 225
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000936 (1723528..1723752) NCBI
- BioCyc: see SPH_RS09095
- MicrobesOnline: 5696690 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATTGAAATACTAATTGTTTTAGCTATTATCCTATCTCTTGCTTTGATTGTATTGGTA
ACTATACAACCCCGTCAAAATCAACTATTTTCCATGGATGCCACTAGTAATATTGGTAAA
CCAAGCTACTGGCAGAGCAACACCTTGGTCAAGGTGCTCACTTTATTGGTGAGTTTGGCT
TTATTTGTTCTACTATTAACCTTTATGGTGATTACTTATAAATAA60
120
180
225
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPH_1866 [new locus tag: SPH_RS09095 ]
- symbol: SPH_1866
- description: conserved hypothetical protein
- length: 74
- theoretical pI: 9.86564
- theoretical MW: 8292.12
- GRAVY: 1.24865
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking preprotein translocase, SecG subunit (TIGR00810; HMM-score: 16.9)Energy metabolism Electron transport cytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 13.9)and 4 moreTransport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 9)Cellular processes Cell division cell division protein FtsL (TIGR02209; HMM-score: 5.2)Cell envelope Surface structures prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 4.3)Protein fate Protein and peptide secretion and trafficking prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 4.3)
- TheSEED :
- FIG01114949: hypothetical protein
- PFAM: no clan defined Asp5; Accessory secretory protein Sec, Asp5 (PF17000; HMM-score: 101.3)and 4 moreSecG; Preprotein translocase SecG subunit (PF03840; HMM-score: 20.7)Cation_ATPase_C; Cation transporting ATPase, C-terminus (PF00689; HMM-score: 12)Thioredoxin (CL0172) OST3_OST6; OST3 / OST6 family, transporter family (PF04756; HMM-score: 9.9)no clan defined MRAP; Melanocortin-2 receptor accessory protein family (PF15183; HMM-score: 8.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9987
- Cell wall & surface Score: 0
- Extracellular Score: 0.0013
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.021164
- TAT(Tat/SPI): 0.000503
- LIPO(Sec/SPII): 0.048449
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIEILIVLAIILSLALIVLVTIQPRQNQLFSMDATSNIGKPSYWQSNTLVKVLTLLVSLALFVLLLTFMVITYK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.