Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 04-FEB-2016
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae INV200
- locus tag: SPNINV200_05000 [new locus tag: SPNINV200_RS02655 ]
- pan locus tag?: PNEUPAN001445000
- symbol: SPNINV200_05000
- pan gene symbol?: —
- synonym:
- product: conserved hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNINV200_05000 [new locus tag: SPNINV200_RS02655 ]
- symbol: SPNINV200_05000
- product: conserved hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 495942..496337
- length: 396
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312029 (495942..496337) NCBI
- BioCyc: see SPNINV200_RS02655
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0490 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTCAAAGAAACTCAATCGTAAAAAACAATTACGAAATGGCCTCCGTCGCGCAGGTGCC
TTTTCAAGTACTGTGACTAAGGTTGTAGATGAGACAAAAAAAGTCGTGAAGCGTGCAGAA
CAGCCAGCAAGCGCAGCTGGTAAGGCTGTTTCTAAAAAAGTTGAACAAGCAGTAGAAGCT
ACCAAAGAGCAAGCTCAAAAAGTAGCTAATTCTGTAGAAGATTTTGCAGCAAACTTGGGG
GGACTTCCACTTGATCGTGCCAAGACTTTCTATGATGAAGGAATCAAGTCTGCTTCAGAT
TTCAAAAACTGGACTGAAAAAGAACTCCTTGCCTTGAAAGGAATCGGCCCAGCTACCATC
AAGAAATTGAAAGAAAATGGCATCAAGTTCAAGTAA60
120
180
240
300
360
396
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNINV200_05000 [new locus tag: SPNINV200_RS02655 ]
- symbol: SPNINV200_05000
- description: conserved hypothetical protein
- length: 131
- theoretical pI: 10.8401
- theoretical MW: 14304.4
- GRAVY: -0.649618
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Prophage functions phage tail tape measure protein, TP901 family, core region (TIGR01760; HMM-score: 17.1)Transport and binding proteins Amino acids, peptides and amines mitochondrial import inner membrane, translocase subunit (TIGR00984; HMM-score: 13.8)
- TheSEED :
- FIG01114159: hypothetical protein
- PFAM: HHH (CL0198) HHH_5; Helix-hairpin-helix domain (PF14520; HMM-score: 25.4)no clan defined ApoLp-III; Apolipophorin-III precursor (apoLp-III) (PF07464; HMM-score: 22.9)and 12 moreHHH (CL0198) HHH; Helix-hairpin-helix motif (PF00633; HMM-score: 18)no clan defined BAF; Barrier to autointegration factor (PF02961; HMM-score: 16.6)DUF5089; Domain of unknown function (DUF5089) (PF17002; HMM-score: 16.6)DUF763; Protein of unknown function (DUF763) (PF05559; HMM-score: 15.9)VBS-like (CL0705) GCIP; Grap2 and cyclin-D-interacting (PF13324; HMM-score: 14.1)DinB (CL0310) DUF1993; Domain of unknown function (DUF1993) (PF09351; HMM-score: 13.8)HHH (CL0198) DNA_pol_lambd_f; Fingers domain of DNA polymerase lambda (PF10391; HMM-score: 13)no clan defined DUF6468; Domain of unknown function (DUF6468) (PF20072; HMM-score: 12.5)DUF6161; Family of unknown function (DUF6161) (PF19658; HMM-score: 12.4)ATP_synthase (CL0255) ATP-synt_B; ATP synthase B/B' CF(0) (PF00430; HMM-score: 12.3)no clan defined Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 12.2)YtxH; YtxH-like protein (PF12732; HMM-score: 9.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.2297
- Cytoplasmic Membrane Score: 0.1632
- Cell wall & surface Score: 0.1543
- Extracellular Score: 0.4528
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.044377
- TAT(Tat/SPI): 0.037723
- LIPO(Sec/SPII): 0.007739
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CBW34133 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSKKLNRKKQLRNGLRRAGAFSSTVTKVVDETKKVVKRAEQPASAAGKAVSKKVEQAVEATKEQAQKVANSVEDFAANLGGLPLDRAKTFYDEGIKSASDFKNWTEKELLALKGIGPATIKKLKENGIKFK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0490 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]