Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_1255 [new locus tag: SP_RS06150 ]
- pan locus tag?: PNEUPAN002508000
- symbol: SP_1255
- pan gene symbol?: leuD
- synonym:
- product: putative 3-isopropylmalate dehydratase, small subunit
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_1255 [new locus tag: SP_RS06150 ]
- symbol: SP_1255
- product: putative 3-isopropylmalate dehydratase, small subunit
- replicon: chromosome
- strand: -
- coordinates: 1188879..1189238
- length: 360
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AE005672 (1188879..1189238) NCBI
- BioCyc:
- MicrobesOnline: 116719 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1113 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGCAGGGTCTTCGAGGGAATACGCTGCTTGGGCTCTAGCGGACTATGGTTTTAAGGTC
GTGATTGCAGGATCTTTCGGTGACATTCATTACAATAATGAACTCAATAATGGCATGTTG
CCAATCGTTCAGCCTAGAGAGGTTAGAGAGAAACTAGCCCAGCTAAAACCAACCGACCAG
GTAACTGTGGACTTGGAACAACAAAAAATCATCTCACCAGTTGAAGAATTCACCTTCGAG
ATAGATAGCGAGTGGAAACATAAACTCCTAAATAGTTTGGATGATATCGGTATTACCTTG
CAGTATGAAGAGTTGATTGCTGCTTATGAAAAACAACGACCAGCCTACTGGCAGGATTAG60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_1255 [new locus tag: SP_RS06150 ]
- symbol: SP_1255
- description: putative 3-isopropylmalate dehydratase, small subunit
- length: 119
- theoretical pI: 4.30693
- theoretical MW: 13691.3
- GRAVY: -0.428571
⊟Function[edit | edit source]
- reaction: EC 4.2.1.33? ExPASy3-isopropylmalate dehydratase (2R,3S)-3-isopropylmalate = (2S)-2-isopropylmalate
- TIGRFAM: Amino acid biosynthesis Pyruvate family 3-isopropylmalate dehydratase, small subunit (TIGR00171; EC 4.2.1.33; HMM-score: 117)and 7 more3-isopropylmalate dehydratase, small subunit (TIGR02087; HMM-score: 49.7)Amino acid biosynthesis Pyruvate family 3-isopropylmalate dehydratase, small subunit (TIGR02084; EC 4.2.1.33; HMM-score: 39.6)Energy metabolism TCA cycle aconitate hydratase 1 (TIGR01341; EC 4.2.1.3; HMM-score: 32)Energy metabolism TCA cycle putative aconitate hydratase (TIGR01342; EC 4.2.1.3; HMM-score: 29.7)Amino acid biosynthesis Aspartate family homoaconitase (TIGR00139; EC 4.2.1.36; HMM-score: 26.7)Energy metabolism TCA cycle aconitate hydratase, mitochondrial (TIGR01340; EC 4.2.1.3; HMM-score: 16.7)2-methylisocitrate dehydratase, Fe/S-dependent (TIGR02333; EC 4.2.1.99; HMM-score: 12)
- TheSEED :
- 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)
Amino Acids and Derivatives Branched-chain amino acids Branched-Chain Amino Acid Biosynthesis 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)and 1 more - PFAM: Leu-IlvD (CL0364) Aconitase_C; Aconitase C-terminal domain (PF00694; HMM-score: 71.1)and 3 moreno clan defined TCAD3; Ternary complex associated domain 3 (PF19972; HMM-score: 12.9)AbrB (CL0132) MazE_antitoxin; Antidote-toxin recognition MazE, bacterial antitoxin (PF04014; HMM-score: 12.3)NADP_Rossmann (CL0063) Pyr_redox_2; Pyridine nucleotide-disulphide oxidoreductase (PF07992; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9859
- Cytoplasmic Membrane Score: 0.0038
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0101
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009851
- TAT(Tat/SPI): 0.000854
- LIPO(Sec/SPII): 0.00318
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAGSSREYAAWALADYGFKVVIAGSFGDIHYNNELNNGMLPIVQPREVREKLAQLKPTDQVTVDLEQQKIISPVEEFTFEIDSEWKHKLLNSLDDIGITLQYEELIAAYEKQRPAYWQD
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1113 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)