Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 23-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_RS02090 [old locus tag: SP_0423 ]
- pan locus tag?: PNEUPAN001267000
- symbol: accB
- pan gene symbol?: accB
- synonym:
- product: acetyl-CoA carboxylase biotin carboxyl carrier protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
- Location: NC_003028 (400947..401432) NCBI
- BioCyc:
- MicrobesOnline: see SP_0423
- PneumoBrowse for strain D39V: SPV_0386 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAATTTAAACGATATTAAAGACTTGATGACTCAATTTGACCAGTCAAGTTTGAGAGAA
TTTTCTTATAAAAATGGGACGGATGAGTTGCAGTTTAGCAAGAATGAAGCAAGACCTGTG
CCTGAAGTTGCAACTCAAGTCGCTCCAGCACCCGTTCTAGCAACACCGAGTCCAGTAGCT
CCTACATCTGCTCCAGCAGAGACTGTAGCAGAAGAAGTTCCAGCTCCAGCTGAAGCAAGT
GTGGCTACTGAGGGAAATCTTGTAGAGAGTCCACTTGTTGGAGTGGTTTACTTGGCTGCT
GGACCAGATAAACCTGCCTTCGTTACAGTTGGTGATAGTGTCAAAAAAGGTCAAACATTG
GTAATTATCGAAGCCATGAAAGTCATGAATGAAATCCCAGCTCCTAAGGATGGTGTGGTA
ACGGAAATTCTCGTCTCTAACGAAGAAATGGTTGAGTTTGGTAAAGGATTGGTACGTATC
AAATGA60
120
180
240
300
360
420
480
486
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_RS02090 [old locus tag: SP_0423 ]
- symbol: AccB
- description: acetyl-CoA carboxylase biotin carboxyl carrier protein
- length: 161
- theoretical pI: 4.17105
- theoretical MW: 17033.3
- GRAVY: -0.0192547
⊟Function[edit | edit source]
- reaction: EC 6.4.1.2? ExPASyAcetyl-CoA carboxylase ATP + acetyl-CoA + HCO3(-) = ADP + phosphate + malonyl-CoA
- TIGRFAM: Fatty acid and phospholipid metabolism Biosynthesis acetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 139.6)and 13 moreTransport and binding proteins Cations and iron carrying compounds oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 40.6)Energy metabolism Other oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 40.6)Central intermediary metabolism Nitrogen metabolism urea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 40.5)Energy metabolism Pyruvate dehydrogenase dihydrolipoyllysine-residue acetyltransferase (TIGR01348; EC 2.3.1.12; HMM-score: 33.8)Energy metabolism Glycolysis/gluconeogenesis pyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 31.7)Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 31.3)2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (TIGR02927; EC 2.3.1.61; HMM-score: 27.7)Transport and binding proteins Unknown substrate efflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 24.6)glycine cleavage protein H-like protein (TIGR03077; HMM-score: 16.2)Energy metabolism Amino acids and amines glycine cleavage system H protein (TIGR00527; HMM-score: 16.1)Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 12.8)Cellular processes Biosynthesis of natural products NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 11.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 11.3)
- TheSEED: see SP_0423
- PFAM: Hybrid (CL0105) Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 72.9)and 6 moreBiotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 24.9)GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 21.3)RnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 17.3)HlyD_D23; Barrel-sandwich domain of CusB or HlyD membrane-fusion (PF16576; HMM-score: 14.6)no clan defined DEC-1_N; DEC-1 protein, N-terminal region (PF04625; HMM-score: 12.4)POTRA (CL0191) YqfD; Putative stage IV sporulation protein YqfD (PF06898; HMM-score: 11)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8974
- Cytoplasmic Membrane Score: 0.0724
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.0293
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.027977
- TAT(Tat/SPI): 0.069952
- LIPO(Sec/SPII): 0.00266
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNLNDIKDLMTQFDQSSLREFSYKNGTDELQFSKNEARPVPEVATQVAPAPVLATPSPVAPTSAPAETVAEEVPAPAEASVATEGNLVESPLVGVVYLAAGPDKPAFVTVGDSVKKGQTLVIIEAMKVMNEIPAPKDGVVTEILVSNEEMVEFGKGLVRIK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SP_RS02050 > SP_RS02055 > SP_RS02060 > SP_RS02065 > fabK > fabD > fabG > fabF > accB > fabZ > accC > accD > SP_RS02110 > briC > SP_RS02120 > SP_RS11730StringTie [2] : SP_RS02050 > SP_RS02055 > SP_RS02060 > SP_RS02065 > fabK > fabD > fabG > fabF > accB > fabZ > accC > accD > SP_RS02110 > briC > SP_RS02120 > SP_RS11730
⊟Regulation[edit | edit source]
- regulator: FabT* see SP_0423
⊟Transcription[edit | edit source]
- transcription start site: see SP_0423
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0386 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Jane A Thanassi, Sandra L Hartman-Neumann, Thomas J Dougherty, Brian A Dougherty, Michael J Pucci
Identification of 113 conserved essential genes using a high-throughput gene disruption system in Streptococcus pneumoniae.
Nucleic Acids Res: 2002, 30(14);3152-62
[PubMed:12136097] [WorldCat.org] [DOI] (I p)Tim van Opijnen, Andrew Camilli
A fine scale phenotype-genotype virulence map of a bacterial pathogen.
Genome Res: 2012, 22(12);2541-51
[PubMed:22826510] [WorldCat.org] [DOI] (I p) - ↑ 2.0 2.1 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)