Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 23-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_RS02095 [old locus tag: SP_0424 ]
- pan locus tag?: PNEUPAN001268000
- symbol: fabZ
- pan gene symbol?: fabZ
- synonym:
- product: 3-hydroxyacyl-ACP dehydratase FabZ
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
- Location: NC_003028 (401429..401851) NCBI
- BioCyc:
- MicrobesOnline: see SP_0424
- PneumoBrowse for strain D39V: SPV_0387 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGATCGATATTCAAGGAATCAAAGAAGCTCTTCCCCACCGTTATCCTATGCTTCTAGTG
GACCGTGTCTTGGAAGTGAGCGAGGATACCATTGTTGCTATCAAAAATGTGACCATCAAC
GAGCCTTTCTTTAACGGCCACTTTCCTCAATACCCAGTTATGCCAGGTGTTGTGATTATG
GAAGCCTTGGCGCAAACTGCCGGTGTGTTGGAGTTATCAAAACCTGAAAATAAAGGAAAA
CTGGTCTTTTACGCTGGTATGGACAAGGTTAAGTTCAAGAAGCAAGTTGTACCAGGCGAC
CAATTGGTTATGACAGCGACTTTTGTAAAACGTCGTGGCACCATAGCTGTGGTTGAAGCA
AAGGCTGAAGTGGATGGCAAGCTTGCAGCCAGTGGTACCCTTACTTTTGCAATTGGGAAC
TAA60
120
180
240
300
360
420
423
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_RS02095 [old locus tag: SP_0424 ]
- symbol: FabZ
- description: 3-hydroxyacyl-ACP dehydratase FabZ
- length: 140
- theoretical pI: 8.91087
- theoretical MW: 15271.9
- GRAVY: 0.175
⊟Function[edit | edit source]
- reaction: EC 4.2.1.59? ExPASy3-hydroxyacyl-[acyl-carrier-protein] dehydratase A (3R)-3-hydroxyacyl-[acyl-carrier protein] = a trans-2-enoyl-[acyl-carrier protein] + H2O
- TIGRFAM: Fatty acid and phospholipid metabolism Biosynthesis beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ (TIGR01750; EC 4.2.1.-; HMM-score: 202.1)and 1 moreFatty acid and phospholipid metabolism Biosynthesis beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA (TIGR01749; EC 4.2.1.59; HMM-score: 40.6)
- TheSEED: see SP_0424
- PFAM: HotDog (CL0050) FabA; FabA-like domain (PF07977; HMM-score: 119.1)and 2 more4HBT; Thioesterase superfamily (PF03061; HMM-score: 20.7)MaoC_dehydratas; MaoC like domain (PF01575; HMM-score: 15.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9805
- Cytoplasmic Membrane Score: 0.0088
- Cell wall & surface Score: 0
- Extracellular Score: 0.0107
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001789
- TAT(Tat/SPI): 0.000076
- LIPO(Sec/SPII): 0.000437
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIDIQGIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFFNGHFPQYPVMPGVVIMEALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQLVMTATFVKRRGTIAVVEAKAEVDGKLAASGTLTFAIGN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SP_RS02050 > SP_RS02055 > SP_RS02060 > SP_RS02065 > fabK > fabD > fabG > fabF > accB > fabZ > accC > accD > SP_RS02110 > briC > SP_RS02120 > SP_RS11730StringTie [2] : SP_RS02050 > SP_RS02055 > SP_RS02060 > SP_RS02065 > fabK > fabD > fabG > fabF > accB > fabZ > accC > accD > SP_RS02110 > briC > SP_RS02120 > SP_RS11730
⊟Regulation[edit | edit source]
- regulator: FabT* see SP_0424
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0387 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Jane A Thanassi, Sandra L Hartman-Neumann, Thomas J Dougherty, Brian A Dougherty, Michael J Pucci
Identification of 113 conserved essential genes using a high-throughput gene disruption system in Streptococcus pneumoniae.
Nucleic Acids Res: 2002, 30(14);3152-62
[PubMed:12136097] [WorldCat.org] [DOI] (I p)Tim van Opijnen, Andrew Camilli
A fine scale phenotype-genotype virulence map of a bacterial pathogen.
Genome Res: 2012, 22(12);2541-51
[PubMed:22826510] [WorldCat.org] [DOI] (I p) - ↑ 2.0 2.1 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)