Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 23-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_RS02120 [old locus tag: SP_0430 ]
- pan locus tag?: PNEUPAN001273000
- symbol: SP_RS02120
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_RS02120 [old locus tag: SP_0430 ]
- symbol: SP_RS02120
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 405259..405732
- length: 474
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGAAACACAAAAAAACTAAGACAATTTGGAATATTTTTGCTTATTATTTTACTATCT
ACCTATTTACCACAAACAATTGGATTGTATGTGACGATCATTTTAGGGTTAGGAGCTGAT
GTCTATTCTCTTATTTTAACAATGGGATTAGTGGGAAGTTTCCTTCTATTAATTTGGAGG
TTAAAAAAGAAAAAGATGCTCTTTATCTTTGAGAAAAAGAGCTGGAACTGGTCATTTGTC
TTCTACTTATTTGCAACTTATGTGGTTTATCAGATTCTCGGTAATTTTTGGGCACGCTAT
GCTCATTTGATTAATCATAGGAATATTCATGATGAGTATTTTACCGTGCTTTTTTCAAAT
GGACAACCAACCTTTTTATCGACTATCTTATCTTTTGTCCTGCCTGTAATCATCGGTCCT
GTTTTTGAGGAGACTCTTGATAGAGGGTATTTTATGAATACCTTCTTTCCCTAG60
120
180
240
300
360
420
474
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_RS02120 [old locus tag: SP_0430 ]
- symbol: SP_RS02120
- description: hypothetical protein
- length: 157
- theoretical pI: 10.1224
- theoretical MW: 18471.9
- GRAVY: 0.603185
⊟Function[edit | edit source]
- TIGRFAM: sortase B cell surface sorting signal (TIGR03063; HMM-score: 7.2)
- TheSEED: see SP_0430
- PFAM: Peptidase_U (CL0472) Rce1-like; Type II CAAX prenyl endopeptidase Rce1-like (PF02517; HMM-score: 12.9)and 1 moreno clan defined CPP1-like; Protein CHAPERONE-LIKE PROTEIN OF POR1-like (PF11833; HMM-score: 6.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9987
- Cell wall & surface Score: 0
- Extracellular Score: 0.0011
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.021768
- TAT(Tat/SPI): 0.00031
- LIPO(Sec/SPII): 0.044541
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRNTKKLRQFGIFLLIILLSTYLPQTIGLYVTIILGLGADVYSLILTMGLVGSFLLLIWRLKKKKMLFIFEKKSWNWSFVFYLFATYVVYQILGNFWARYAHLINHRNIHDEYFTVLFSNGQPTFLSTILSFVLPVIIGPVFEETLDRGYFMNTFFP
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SP_RS02050 > SP_RS02055 > SP_RS02060 > SP_RS02065 > fabK > fabD > fabG > fabF > accB > fabZ > accC > accD > SP_RS02110 > briC > SP_RS02120 > SP_RS11730StringTie [1] : SP_RS02050 > SP_RS02055 > SP_RS02060 > SP_RS02065 > fabK > fabD > fabG > fabF > accB > fabZ > accC > accD > SP_RS02110 > briC > SP_RS02120 > SP_RS11730
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)